CAZyme Information: MGYG000001394_00733

Basic Information

• Species: Yokenella regensburgei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yokenella; Yokenella regensburgei
• CAZyme ID: MGYG000001394_00733
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
875	MGYG000001394_6|CGC1	96065.93	4.6044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001394	4680112	Isolate	not provided	not provided

• Gene Location: Start: 37750; End: 40377 Strand: -

Full Sequence      

MNTNESKPSLGAVAATVTVTMNDDTNTLLGLNNSMMISRDGGHFWEAYNEYYRNYFPGSP
LVMVAKLQELALNSEDYDLNKTYSGGDVVRDQGYYWTAQWWVDQGISPGSDSVWLKGDAI
SYERYGTFQFSPFTGDKATQIQTKGKQDAAKQRKVIGYFPEWGVYEAHDYFTPDKIDFSK
LTHLNYGFAVVEEGQVIIHDTVKGPGLLRQLAKMTKAHGVTSMVSVGGWTNSAEGVFEAA
TATAAGIETLAESMVAFVRRWDFDGLDVDWEYPDNNTEKANFTTLIQKLRSKLDAAGLLD
DKYYQLSAAVTTNHNNIQFINPAVTAPLLDSVNVMAYDIHGAFDAITGHNAPLFANSEDA
DQLLNVSSAMQAYCVTWGVPKYKLMMGVPFYGRGWGNVAATQVVKGLPGLFCSGSATVHG
AWDDEGDYTGTNPFYVLKQKLASADYTRYWDDESKVPYLYNAKTKEFLTYDDAESIQTKV
NYINDQGFGGAIIWDISGDTGDFELGTIVGTLKNSPITNFDTPKIHFFTGNNYAGAKISV
SDNIPDLKDVYTDDGHSADNTISSSKNDVDSLGYFIFTDNYYNFGVENSTATRVYGDLAK
FGNLYNDKCSSFKIIKMIGYASEDTTKGEVVAFVEDCPDLTESRGYNITSIKLLPGYCVR
LYEGIHYTGAYRDVMGSPFPTNLSTIGFDKRVYSARFINLKVAPKATFFDGSNYSGNTFD
LYSDVPTFTGVVNSGGVSANDMISSATHAKDCLGYEVYTGDDFTGSATVVKGDLTTYNST
FNNNASSIREVKAFLYSGTNFSGNEHAVSINNVVLGDTGVTNIKSIKVAKGYAARIYDQT
WHTGNSIVIADTDSCLDLATLGFANKVLSIMFIKL

Enzyme Prediction     

No EC number prediction in MGYG000001394_00733.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	152	502	1.3e-79	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	1.36e-97	155	499	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	5.21e-95	154	499	1	334	Glyco_18 domain.
COG3325	ChiA	1.52e-82	152	499	37	423	Chitinase, GH18 family [Carbohydrate transport and metabolism].
pfam00704	Glyco_hydro_18	6.68e-78	154	499	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	1.36e-74	155	503	1	343	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU90737.1	0.0	1	875	1	875
QKN80477.1	3.78e-274	13	754	20	799
QQN33113.1	2.66e-262	13	872	20	954
AZP47812.1	1.32e-258	13	870	20	947
AZP43474.1	1.32e-258	13	870	20	947

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KST_A	5.91e-68	154	499	8	357	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	3.01e-67	154	499	8	357	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
1ITX_A	4.02e-66	148	499	7	406	ChainA, Glycosyl Hydrolase [Niallia circulans]
6KXN_A	5.58e-66	154	499	8	357	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6BT9_A	3.04e-58	148	522	31	480	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	9.77e-63	148	499	39	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
A6N6J0	9.51e-51	158	499	44	390	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
P48827	1.62e-48	145	499	25	383	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
P32470	1.70e-46	139	497	19	381	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
E9ERT9	9.53e-43	158	514	44	397	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001394_00733.