CAZyme Information: MGYG000001394_01174

Basic Information

• Species: Yokenella regensburgei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yokenella; Yokenella regensburgei
• CAZyme ID: MGYG000001394_01174
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000001394_12|CGC9	40569.86	8.476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001394	4680112	Isolate	not provided	not provided

• Gene Location: Start: 272527; End: 273606 Strand: +

Full Sequence      

MTVTTSSRTLSTPHRILIIKLRHHGDMLLVTPVINELKQQYPNADIDVLLYEETRDMLAA
NASIHRIFAIDRKWKKAGVRYQLGQEWQLLRQLRSQRYDIVLNLADQWRSAIITRITGAP
VRLGFAFPKRDHPFWRYCHSELVSTEGHSNMHTVRQNLSILAPLFTLPATAAHATMAYSD
DDWQQCAAKLPEQVAARYVVVQPTSRWFFKCWREGRMSEVINALTAAGHYVILTSGPDAK
EKEMVSTILNGCDAEKVISLAGQLTLRQLAALIDHATLFIGVDSVPMHMAAALQTPLIAL
FGPSKLTFWRPWQAKGEVIWAGDFGPLPDPDEIDTRTQERYLDLIPSQVVIDAAKRLLA

Enzyme Prediction     

No EC number prediction in MGYG000001394_01174.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	87	322	6.6e-59	0.9022222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02201	heptsyl_trn_III	6.27e-177	15	359	1	344	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	1.53e-117	13	358	5	343	lipopolysaccharide core biosynthesis protein; Provisional
COG0859	RfaF	5.95e-78	13	359	1	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	3.82e-76	15	356	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	1.03e-53	87	329	2	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU90963.1	4.72e-265	1	359	1	359
CAD5351335.1	1.82e-193	1	358	1	356
AKL14527.1	5.48e-188	13	359	13	358
AUV03509.1	7.78e-188	13	359	13	358
QIH66080.1	2.59e-186	13	359	13	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	6.18e-15	15	358	10	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	3.14e-12	15	319	2	305	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
2GT1_A	1.62e-11	15	304	2	282	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	1.62e-11	15	304	2	282	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.70e-11	15	304	2	282	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	3.70e-89	21	358	1	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	1.38e-84	21	358	1	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P37692	1.11e-13	15	319	2	305	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P45042	8.83e-13	25	319	12	305	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37421	1.20e-12	15	319	2	305	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001394_01174.