CAZyme Information: MGYG000001394_02282

Basic Information

• Species: Yokenella regensburgei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yokenella; Yokenella regensburgei
• CAZyme ID: MGYG000001394_02282
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000001394_16|CGC5	39803.51	5.0362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001394	4680112	Isolate	not provided	not provided

• Gene Location: Start: 311655; End: 312728 Strand: -

Full Sequence      

MKPQQLIPALERVVHGFCQLKGMGELSASKGLAIQFEQWEWEVGVGLYGFWRYALHQNDA
ALQASLLDWYEGQIAKGLPAMQINTTAPMITLALLAGHGDRADLRTAVSAWADDLMANLP
RTEEGGFQHVVKEQPNTGQLWDDTLFMTCLFLGTAGIVLKRQDLIDEAVYQFLLHTRYLS
DPRSGLWYHGWTFLGNHHFAGAFWARGNAWITVAIPEFIDLMGEHLDAGTRRFLTQVVSR
QVHTLCDLQAENGMWHTVLDDPYSPQESSATAGMAYGMLRGVRLGLLDEAVVEPALRAAR
AVWQRIDADGIVLEASKGTMVGHDHQYYCDIAIAPVPYAQALTMLLLLELEQGQWLA

Enzyme Prediction     

No EC number prediction in MGYG000001394_02282.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	352	1.9e-91	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.37e-94	39	344	34	343	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.28e-83	38	344	26	333	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU92162.1	7.58e-270	1	357	1	357
ALR75859.1	5.98e-267	1	357	1	357
ADO49508.1	5.98e-267	1	357	1	357
VEG96248.1	4.19e-242	1	357	1	357
AVP94494.1	3.44e-241	1	357	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	2.56e-85	5	349	25	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.68e-80	39	349	66	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	1.02e-79	36	349	44	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	9.60e-14	118	302	108	298	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.53e-36	39	328	29	312	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	2.99e-10	156	300	10	160	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.99e-10	156	300	10	160	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	4.00e-07	141	312	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001394_02282.