CAZyme Information: MGYG000001394_03022

Basic Information

• Species: Yokenella regensburgei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yokenella; Yokenella regensburgei
• CAZyme ID: MGYG000001394_03022
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	MGYG000001394_16|CGC16	85392.89	4.6044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001394	4680112	Isolate	not provided	not provided

• Gene Location: Start: 1084693; End: 1087044 Strand: +

Full Sequence      

MNSQFTRIIAAMTAEEKVDLLTGNGLWRTASLPQYGIADIVMTDGTYGVRYSSAQIDGSE
KWSMDDFISVITQTADKANGEESAAKGGSEALFSTSLPATCFPNGSSLACSWDIDLVQQM
GQALGRECQHMGVGILLGPGINIRRTPLAGRGYEYYAEDPVVSGDIAAALINGLQQEGVG
ASLKHFAANNSEYRRTEMDSVVEERALREIYLAGFRRAIDKSQPWTVMSSYNRLNGVQTS
QDPFLLTQVLREEWGYDGLVMSDWYGIKDRPASLMAGNDLAMPETRRDKQTLLAAINAGE
VPMAVVDTACLRMLALLDKVQRHRRPDTQADFPAHHALSQHLAAESIVLLKNDDNLLPLR
AEKTPRIAVLGKPAQEPVIQGSGCATTVPYLLDRPLDEIFDLAGDDFTVSWAVGAPDDVQ
SDEQALAQAREVASQADVAVIFVSTAVGEDGENGDRHDLNILAVHERLIHEVSAVQPNVV
VVLANSDAVVMPWLPQCKSLLETFFAGQGMGRAVAEILFGKRNPSGKLTVTVPNTLEETP
AWLHYPGENLQHYYGEGLFVGYRYYDKRRIAPLFPFGFGLSYTRFTYSNLTLSAPEAGEN
DTVMVSFDLTNSGECAGKEVVQLYVSAPQGELIREEQALKAFSKVALAAGETTRVTLALP
IADLACYHPGLKAWVVTPGDWQIRVGGSSRDLPLEAVLNVACPPRFVPLRDDNSLQQLIQ
QPEAFARVVALIASKSPVSPEQIREKLIRLAPDLFCGLLIALTEFLALDITREELNAVLA
GHE

Enzyme Prediction     

No EC number prediction in MGYG000001394_03022.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	75	283	6.5e-63	0.8935185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	8.48e-99	100	691	118	756	beta-glucosidase BglX.
COG1472	BglX	2.23e-67	99	392	80	380	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.40e-58	347	562	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	1.74e-46	99	657	111	740	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.58e-43	99	316	85	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU88686.1	0.0	1	783	1	783
QLT76801.1	0.0	1	781	1	781
QLO37283.1	0.0	1	781	1	781
AVL82302.1	0.0	1	781	1	781
VEF69795.1	0.0	1	781	1	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.95e-183	7	700	7	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.96e-150	12	732	12	694	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.10e-128	8	708	7	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.19e-127	8	708	7	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.68e-90	7	692	8	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.61e-182	7	700	7	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	6.65e-146	12	734	12	705	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	9.36e-146	12	734	12	705	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P27034	1.13e-120	8	692	5	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q0CAF5	4.21e-111	7	692	8	823	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001394_03022.