CAZyme Information: MGYG000001394_03578

Basic Information

• Species: Yokenella regensburgei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yokenella; Yokenella regensburgei
• CAZyme ID: MGYG000001394_03578
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
167		18991.06	9.5122

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001394	4680112	Isolate	not provided	not provided

• Gene Location: Start: 1679710; End: 1680213 Strand: +

Full Sequence      

MKIKSFTPVALTLSLLFPPLVTAQKVDCIVEAAQCFQINPLLIKAIIWQESRNRQQAMNH
NTNSTVDVGIMQINTVHFKALKSLGIDETLLRENSCANVFSGAWVLKQSIERYGYTWDGI
GNYHSKTPVHHDRYVKKIISLIAHQTAVIDKIEVARQEGIRERFVCR

Enzyme Prediction     

No EC number prediction in MGYG000001394_03578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	36	146	1e-15	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	7.18e-50	36	140	1	105	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	2.47e-28	11	138	7	135	type III secretion system invasion protein IagB.
PRK13722	PRK13722	1.01e-17	27	125	21	119	lytic transglycosylase; Provisional
pfam01464	SLT	8.14e-13	29	117	1	85	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13888	PRK13888	7.45e-12	18	139	8	128	conjugal transfer protein TrbN; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU89187.1	3.35e-117	1	167	1	167
AIR07285.1	1.53e-113	1	167	1	167
QAX79449.1	8.77e-104	1	167	1	167
AHM72774.1	2.51e-103	1	167	1	167
AJW29712.1	3.43e-101	1	167	1	167

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	2.93e-12	27	111	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	2.69e-21	27	138	20	135	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	2.69e-21	27	138	20	135	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	1.06e-20	27	138	20	135	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
P17738	7.14e-16	24	125	18	119	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
Q00739	1.40e-15	27	125	21	119	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000237	0.999120	0.000176	0.000162	0.000148	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001394_03578.