CAZyme Information: MGYG000001394_03954

Basic Information

• Species: Yokenella regensburgei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yokenella; Yokenella regensburgei
• CAZyme ID: MGYG000001394_03954
• CAZy Family: GT1
• CAZyme Description: Elloramycin glycosyltransferase ElmGT

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000001394_16|CGC30	40315.17	6.2337

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001394	4680112	Isolate	not provided	not provided

• Gene Location: Start: 2027343; End: 2028467 Strand: +

Full Sequence      

MRILFVGPPLYGLLYPVLSLAQAFRVNGHEVLIASGGKFAQKAAEAGLVVFDAAPGFDSE
ADYRRREALRKESNIGTKMGNFSFFSEEMADQLVEFAGHWRPDLIVYPPLGVVGPLIAAK
YGIPVVMQTVGFGHTPWHIKGVTKSLSDAYRRHGVSAPPQDLAWIDVTPPSMSILQNDGE
PVISMQYVPYNGGAVWESWWERTPGRKRLLVSLGTVKPMVDGLDLISWVMDSASEVDAEI
ILHLSANARSDLRTLPPNVRLVDWIPMGAFLNGADGFIHHGGAGNTLTALHAGIPQIVFG
EGADRPVNARAVVERGCGIIPGDGGLTSGMINNFLNDRSLRDASQEVAAEMAAQPCPTEV
AKRLIAALQKGSSQ

Enzyme Prediction     

No EC number prediction in MGYG000001394_03954.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	137	366	4.8e-34	0.5706806282722513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	9.67e-86	1	374	2	405	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	1.13e-48	1	364	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
pfam06722	DUF1205	2.00e-41	165	260	1	95	Protein of unknown function (DUF1205). This family represents a conserved region of unknown function within bacterial glycosyl transferases. Many family members contain pfam03033.
TIGR01426	MGT	1.01e-28	9	348	4	357	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam00201	UDPGT	1.89e-06	254	328	319	395	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU89531.1	5.40e-274	1	374	1	374
QSB56190.1	2.58e-253	1	371	1	371
QGT29488.1	3.67e-253	1	371	1	371
ATY00979.1	3.67e-253	1	371	1	371
VDZ67911.1	3.67e-253	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AMB_A	1.44e-61	1	366	23	397	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMB_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
4AMG_A	3.99e-61	1	366	23	397	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMG_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_A Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_C Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_D Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
3D0R_A	5.99e-55	1	365	21	393	Crystalstructure of calG3 from Micromonospora echinospora determined in space group P2(1) [Micromonospora echinospora],3D0R_B Crystal structure of calG3 from Micromonospora echinospora determined in space group P2(1) [Micromonospora echinospora],3OTI_A Crystal Structure of CalG3, Calicheamicin Glycostyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3OTI_B Crystal Structure of CalG3, Calicheamicin Glycostyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3D0Q_A	1.43e-51	2	365	22	393	Crystalstructure of calG3 from Micromonospora echinospora determined in space group I222 [Micromonospora echinospora],3D0Q_B Crystal structure of calG3 from Micromonospora echinospora determined in space group I222 [Micromonospora echinospora]
3WAD_A	3.94e-32	14	373	14	418	Crystalstructure of glycosyltransferase VinC involved in the biosynthesis of vicenistatin [Streptomyces halstedii],3WAD_B Crystal structure of glycosyltransferase VinC involved in the biosynthesis of vicenistatin [Streptomyces halstedii],3WAG_A Crystal structure of glycosyltransferase VinC in complex with DTDP [Streptomyces halstedii],3WAG_B Crystal structure of glycosyltransferase VinC in complex with DTDP [Streptomyces halstedii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2V630	3.26e-241	1	371	1	371	Enterobactin C-glucosyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=iroB PE=1 SV=2
Q9F2F9	7.52e-51	1	364	1	369	Elloramycin glycosyltransferase ElmGT OS=Streptomyces olivaceus OX=47716 GN=elmGT PE=1 SV=2
Q9ZGH7	2.01e-36	15	364	15	410	10-deoxymethynolide desosaminyltransferase OS=Streptomyces venezuelae OX=54571 GN=desVII PE=1 SV=1
A4F7P3	1.44e-29	1	360	1	406	3-alpha-mycarosylerythronolide B desosaminyl transferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=eryCIII PE=1 SV=1
Q54824	3.11e-29	17	364	17	414	TDP-daunosamine transferase DnrS OS=Streptomyces peucetius OX=1950 GN=dnrS PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997908	0.002078	0.000040	0.000005	0.000002	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001394_03954.