CAZyme Information: MGYG000001394_04087

Basic Information

• Species: Yokenella regensburgei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yokenella; Yokenella regensburgei
• CAZyme ID: MGYG000001394_04087
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765		83477.06	6.3161

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001394	4680112	Isolate	not provided	not provided

• Gene Location: Start: 2179549; End: 2181846 Strand: -

Full Sequence      

MKWLCSVGVAVSLAIQPALADSLFGNHPLTPEARDAFVTELLKKMTVDEKIGQLRLISVG
PDNPKDAIREMIKDGQVGAIFNTVTRQDIRTMQDQVMQLSRLKIPLFFAYDVIHGQRTVF
PNSLGLASSFNLDAVKTVGRVSAYEAADDGLNMTWAPMVDVSRDPRWGRVSEGFGEDTYL
TAIMGKTMVESMQGKSPADRYSVMTSVKHFAAYGAVEGGKEYNTVDMSPQRLFNDYLPPY
KAALDAGSGGVMVALNSLNGTPASSDSWLLKDILRDDWGFKGITISDHGAIKELIKHGTA
SDPEDAVRIALTSGINMSMSDEYYSKYLPGLVKSGKVTMAELDDATRHVLNVKYDMGLFN
DPYSHLGAKETDPQDTNAESRLHRKEAREVARESLVLLKNRLETLPLKKNAIIAVVGPLA
DSQRDMMGSWSAAGVASQSVTLLTGIQNAVGTEGKVLYAKGANVTNDKGIVEFLNQYEPA
VVVDPRSPQAMIDEAVKAAKQSDVVVAVVGEAQGMAHEASSRTDITIPQSQRDLISALKA
TGKPLVLVLMNGRPLALVKEDQQADAILETWFAGTEGGNAIADVLFGDYNPSGKLPMSFP
RSVGQIPVYYSHLNTGRPYNPEKPNKYTSHYFDEANGPLYPFGYGLSYTTFTVSDVKMSS
PVMKRDGKVTASVEVTNTGKREGATVIQMYVQDVTASMSRPVKQLRGFEKVTLKPGETQT
VSFPIDVNALKFWNQRMKFAAEPGKFNVFIGVDSARVKQGEFELQ

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	98	319	1.5e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	765	1	765	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	3.07e-127	46	352	1	316	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	2.55e-118	45	464	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.81e-87	91	764	61	775	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.26e-72	395	648	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU89654.1	0.0	1	765	1	765
QEH55583.1	0.0	1	764	1	764
QPO96569.1	0.0	1	764	1	764
QRQ75662.1	0.0	1	764	1	764
QET58492.1	0.0	1	764	1	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6R5I_A	0.0	34	764	3	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	0.0	25	764	28	764	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	0.0	34	764	3	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	0.0	34	764	4	733	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5XXL_A	1.32e-223	30	765	6	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	0.0	1	764	1	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	0.0	1	764	1	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	6.78e-129	74	754	34	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.24e-123	24	765	29	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	2.77e-105	15	751	4	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000269	0.999113	0.000176	0.000154	0.000150	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001394_04087.