CAZyme Information: MGYG000001394_04378

Basic Information

• Species: Yokenella regensburgei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yokenella; Yokenella regensburgei
• CAZyme ID: MGYG000001394_04378
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768	MGYG000001394_16|CGC34	84840.53	4.5517

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001394	4680112	Isolate	not provided	not provided

• Gene Location: Start: 2488717; End: 2491023 Strand: -

Full Sequence      

MCADKLMASSLSMNDDTNTISGLTTSHMFSKNNGSKWIAYKDESQNSFPGTVTVIVATKD
EQAIKAVDYDASTNYATTGTLVRYNGSYWTNGWYANAGEIPGSAEVWKKAGTVSISTQAT
FNFTPFTGQKAKDFQSSEKARIAEQRKIIGYFPEWGVYEAHNYFTPDKIDFSQLTHLNYA
FSIVKDGEAVVYDTWKGPELLPQLRELTAQAGVTYMVSFGGWSNVDAFEKAVSTGSGIDK
LVASMVSFMQEYDFDGIDVDWEYPDSSSEKGQFTSLIQKLRSKLDQLGLQQDKYYQLTAA
VTTNHNNVGYINLAVTAPLFDSINVMAYDIHGAFDPITGHNAPLFANHLDSDPLLNVAST
MKVYHETYGVPKRKLMMGIPYYGRGWGGVAPTEKIKGLPGLFATGTATVKGAWDDTDFTG
TNPYYVLKEKLASGAYKRYWDDESKVPYLYNASTKEFLTYDDPESIQTKVDYILDQDFGG
TILWDLSGDTADHELGKIVAQLKDTDVDGGDDEPVISGDIANPALFSQWTDFDVNTYNNI
IRFGLKFDVSESDFLSGQYDIYVNDLLCETVLKGTFTAFHHDDSDTGSNISHNGTTRAGY
SEENGSVITVKSGRLPLHPDDVISVVSQQNGVSQTVLKMTTTRQMLQIGLVAEVDGLENF
TISSWYPNVRNMSYPAATVILSHNYAHKYQVHLNGKCVADMETFADGGHNCDQIHFIGLT
RTADAYCVMPEIAFKQGDDFKLYEVSNGAKTLVGQITVPEGIIYGNTI

Enzyme Prediction     

No EC number prediction in MGYG000001394_04378.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	146	496	4e-81	0.9594594594594594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	6.21e-99	148	489	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	5.84e-98	147	489	1	334	Glyco_18 domain.
COG3325	ChiA	1.18e-85	114	489	6	423	Chitinase, GH18 family [Carbohydrate transport and metabolism].
pfam00704	Glyco_hydro_18	6.25e-81	147	489	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	2.24e-69	151	492	4	342	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QET68290.1	1.11e-248	8	763	23	743
AYL67928.1	1.57e-248	8	763	23	743
QIU88825.1	1.80e-244	8	759	25	729
CBG91178.1	2.48e-244	8	499	23	517
CBG91177.1	8.09e-241	8	558	23	554

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KST_A	3.59e-66	147	502	8	370	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	1.86e-65	147	502	8	370	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	3.58e-64	147	502	8	370	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
1ITX_A	1.12e-58	140	502	6	419	ChainA, Glycosyl Hydrolase [Niallia circulans]
6BT9_A	7.22e-52	144	489	35	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	1.48e-55	140	502	38	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
A6N6J0	1.67e-45	151	489	44	390	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
P48827	1.15e-43	151	496	43	392	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
Q91XA9	1.42e-38	140	489	16	365	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
Q95M17	1.89e-38	140	504	16	385	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001394_04378.