CAZyme Information: MGYG000001395_01007

Basic Information

• Species: Listeria innocua
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria innocua
• CAZyme ID: MGYG000001395_01007
• CAZy Family: GH38
• CAZyme Description: Mannosylglycerate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
875	MGYG000001395_14|CGC6	100140.09	4.7358

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001395	2890785	Isolate	not provided	not provided

• Gene Location: Start: 171288; End: 173915 Strand: +

Full Sequence      

MAKTKVHVIPHSHWDREWYFTSSRSTIYLVKHLKEVIETLEAKDDYHFYLMDAQSSLIED
YLRYCPEDKTRLEKLIAEKRLITGPWYTQTDQLVISQESIVRNLLYGTRIAREMGHSMAV
GYVPDAFGQGGNMPQIYKEFGISKFLFWRGVADNRLKQTEFIWRGDDGTEMLAEQIPFGY
YYGANIPENEAELKTYLDEQIGALEEKASTPNVYFPNGLDQAPVRKNLPELVAKFNELDH
SREYQIASPETFFADLEKDVTDLPVIAGELTEGKHSRLHKSIFSTRADLKQANNEIENFL
SNVLEPVLSISYSLGNRYPHNELAEIWKLMFENAAHDSIGGCNSDTTNRDVKHRYKLASD
LATNLLDLNMRLISEKIAQKQPFQFTVFNPLPYEKSGVIKMTAYIPEDNFTIEDTRGNTL
EYTILEKKDLTEYVLNQHIYLNPSKPVYLPEKVFLATMLVDVNSIPALGYDTIYFNLEKE
VAEQQPKQSAETKIENEFYKIQLADNNSLTIHDKKSGRTYTDQMIFVENGDDGDSYNYSP
PRKDLLISSKEAIIDSVEASVSGINQALTISFKLNVPYNLEERANGEKTKEMTIKTLISL
RKNEELIRFDVQVINQVLSHRLCVTFATEIASKFSTADQLFAPINRPVRLPEMDVWEAEE
WQEAPISIEAMQSFVSLHDESHVVAVMTEGVREYEIIGENYDTISLTLFRTFSHMGKTDL
LYRPGRASGESIVETPDAQLLGEINATFALTLFESSFDEANIAKKAKEYLSNPPVYQISD
FLNGRLIYVYRDEEKTLDSTYSLGLPVIDGAIISAVKKAEDSDAFITRFFNPYLQKEITI
PEIFQGKERHLDESKEAETKTTLAHAKVQTYLFEK

Enzyme Prediction     

No EC number prediction in MGYG000001395_01007.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH38	5	261	1.2e-73	0.9442379182156134

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09819	PRK09819	0.0	1	874	1	875	mannosylglycerate hydrolase.
COG0383	AMS1	0.0	1	875	1	941	Alpha-mannosidase [Carbohydrate transport and metabolism].
cd10815	GH38N_AMII_EcMngB_like	5.52e-158	5	274	1	270	N-terminal catalytic domain of Escherichia coli alpha-mannosidase MngB and its bacterial homologs; glycoside hydrolase family 38 (GH38). The bacterial subfamily is represented by Escherichia coli alpha-mannosidase MngB, which is encoded by the mngB gene (previously called ybgG). MngB exhibits alpha-mannosidase activity that converts 2-O-(6-phospho-alpha-mannosyl)-D-glycerate to mannose-6-phosphate and glycerate in the pathway which enables use of mannosyl-D-glycerate as a sole carbon source. A divalent metal ion is required for its activity.
cd10814	GH38N_AMII_SpGH38_like	1.91e-84	5	274	1	271	N-terminal catalytic domain of SPGH38, a putative alpha-mannosidase of Streptococcus pyogenes, and its prokaryotic homologs; glycoside hydrolase family 38 (GH38). The subfamily is represented by SpGH38 of Streptococcus pyogenes, which has been assigned as a putative alpha-mannosidase, and is encoded by ORF spy1604. SpGH38 appears to exist as an elongated dimer and display alpha-1,3 mannosidase activity. It is active on disaccharides and some aryl glycosides. SpGH38 can also effectively deglycosylate human N-glycans in vitro. A divalent metal ion, such as a zinc ion, is required for its activity. SpGH38 is inhibited by swainsonine. The absence of any secretion signal peptide suggests that SpGH38 may be intracellular.
pfam01074	Glyco_hydro_38	1.10e-73	5	267	1	271	Glycosyl hydrolases family 38 N-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAC95657.1	0.0	1	875	1	875
QUR86279.1	0.0	1	875	1	875
QGF42569.1	0.0	1	875	1	875
AGR02854.1	0.0	1	875	7	881
CDM18967.1	0.0	1	875	3	877

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WYH_A	9.19e-97	1	875	23	922	Structureof the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYH_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYI_A Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS],2WYI_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS]
5KBP_A	2.90e-94	1	752	4	782	Thecrystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],5KBP_B The crystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
3LVT_A	7.18e-91	2	831	5	849	TheCrystal Structure of a Protein in the Glycosyl Hydrolase Family 38 from Enterococcus faecalis to 2.55A [Enterococcus faecalis V583]
5JM0_A	4.83e-13	4	341	302	644	Structureof the S. cerevisiae alpha-mannosidase 1 [Saccharomyces cerevisiae S288C]
6LZ1_A	1.29e-11	3	439	280	727	Structureof S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_B Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_C Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_D Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54746	5.00e-178	2	832	3	822	Mannosylglycerate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mngB PE=1 SV=2
Q9KER1	2.43e-76	1	840	1	854	Putative mannosylglycerate hydrolase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=mngB PE=3 SV=2
Q91W89	2.42e-21	6	401	252	639	Alpha-mannosidase 2C1 OS=Mus musculus OX=10090 GN=Man2c1 PE=1 SV=1
P21139	4.95e-20	6	356	252	596	Alpha-mannosidase 2C1 OS=Rattus norvegicus OX=10116 GN=Man2c1 PE=1 SV=1
Q9NTJ4	5.83e-19	6	401	253	640	Alpha-mannosidase 2C1 OS=Homo sapiens OX=9606 GN=MAN2C1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001395_01007.