CAZyme Information: MGYG000001395_01403

Basic Information

• Species: Listeria innocua
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria innocua
• CAZyme ID: MGYG000001395_01403
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000001395_14|CGC14	39898.09	4.5596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001395	2890785	Isolate	not provided	not provided

• Gene Location: Start: 554391; End: 555416 Strand: +

Full Sequence      

MKWSEYANLAQQSLEKFYLADTKEQFLNNFYPTENPEEDNKVFNYWWLAHLVEVRLDAYL
RTKKQADLEVAEKTYLHNKNRNGGTLIHDFYDDMLWNALAAYRLYKATGKSIYLEDAQLV
WQDLVDTGWNDIMGGGFAWRRPQMYYKNTPVNAPFIILSCWLYNELNETKYLEWAMKTYE
WQTKVLVREDGFVEDGINRLEDGSIDYEWKFTYNQGVYIGANLELYRITKEAKYLDTANK
TAAISLKELTEDGIFKDEGNGGDEGLFKGIFYRYFTDLIEETANKTYRDFVLNSCQILVE
NAKLDGYLLMGMNWKEKPSGKIPYSAELSGMIALEMAAKLE

Enzyme Prediction     

No EC number prediction in MGYG000001395_01403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	23	327	7.3e-87	0.8687150837988827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	0.0	1	341	1	353	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	7.91e-32	20	283	6	299	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
pfam00759	Glyco_hydro_9	0.004	88	175	209	284	Glycosyl hydrolase family 9.
COG1331	YyaL	0.009	36	137	402	511	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAC95995.1	1.76e-260	1	341	1	341
QUR86618.1	6.12e-259	1	341	1	341
QGF42238.1	1.75e-258	1	341	1	341
ALQ15877.1	1.88e-253	1	341	1	341
CBY62768.1	1.88e-253	1	341	1	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	1.73e-252	2	341	2	341	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	4.83e-64	3	341	54	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.52e-62	3	341	55	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	1.18e-61	3	341	55	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4BOK_A	2.87e-23	44	286	37	282	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05031	1.62e-06	109	317	145	370	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001395_01403.