CAZyme Information: MGYG000001395_02433

Basic Information

• Species: Listeria innocua
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria innocua
• CAZyme ID: MGYG000001395_02433
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552		64211.97	6.0217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001395	2890785	Isolate	not provided	not provided

• Gene Location: Start: 1505; End: 3163 Strand: +

Full Sequence      

MPWRGVLDELENKIIDQLTEAEEHATYNGKWHGFLTIGYKNKRATVINFSYLCLANLINE
MKKSALKNQTEEAISFKMDIAVNYQLENLGEWNRKALKTKKNYYRRGIALNENFKIALME
QEINANAILLPGDEGLAINVENMNRYLIQANKNQAQLNLTIDSSVVTFETVGWFFDGKNI
HELETASLDHGRRKVEYLTPEIISTLVENAGEYLAHQVNTTGEFNYGWFACFDKKIKHYN
SLRHASTTYSMLEAYELTGNKAILEAATKALTYLEKHFIYEKDDMAFLIEPELREVKLGG
SAATLLALTKYMHITGTKTYLPLCRKIANAILSLQDENGKFTHVLEYPSLEVKDIFRIIY
YDGEAVFGLLRLYEIDRDSKWLDAAAKSFNHFIQDKYWQNHDHWLSYCANEITKYIKDEA
YYEFGLQNAFDNLPFIYERETTFPTFLELTVATKEMTLRMEAEGQQALLTSYSLENLEKT
ITKRALYQLNGYFYPELAMYYKNPDRIEGSFFIRHQSFRVRIDDVEHNISGYVRYYQLLK
QGKLSTEAESVR

Enzyme Prediction     

No EC number prediction in MGYG000001395_02433.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04434	LanC_like	2.59e-05	201	331	119	251	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
COG1331	YyaL	1.43e-04	249	392	418	567	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04434	LanC_like	1.99e-04	249	451	9	184	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04792	LanM-like	3.09e-04	245	391	549	682	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
cd04434	LanC_like	0.004	299	404	2	96	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLF93148.1	7.18e-122	85	541	76	544
ASG64311.1	1.54e-121	63	535	402	884
QGX91315.1	2.85e-120	98	535	99	542
QBG08983.1	2.20e-116	67	535	68	544
AGB80024.1	4.02e-116	67	543	68	551

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001395_02433.