CAZyme Information: MGYG000001396_03339

Basic Information

• Species: Clostridium_AQ innocuum
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ innocuum
• CAZyme ID: MGYG000001396_03339
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000001396_3|CGC12	55833.08	5.4821

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001396	4835467	Isolate	not provided	not provided

• Gene Location: Start: 746866; End: 748305 Strand: +

Full Sequence      

MNEEFLWGGSTSSFQFEGGAFEDGKGKSIYDVITENSKHNVDQSFEAWMGANKVRDYSIT
SDFYHHYEEDIKLLAEMGFRAFRMSIAWTRLYPDGDGSLNQKGVDFYKRVFKLLKKSGIE
PVVTLYHWDMPQSLVDRYNGWYGIETVHAFKQYVDTCFQEFGCYVSYWLTLNENNMTLKM
PTFGIGKKMTPETVGYKEFSYTIYHNTNIAHFYAVKRCHEILPHAKIGCMIASSLAYPLT
SDPEDVFLAQQHNQELTYDYLDLLCKGEYTSKNIKQFEKDGWHGYRHEEALFKDEKAKID
FISFSYYYSVCVGKESNAINENAETLQMMYQALRNPKLKQSSFGWTIDPLGLRILMNDLY
DRYNLPLMIVENGLGVKDDNLTKDKKVHDDYRIAYLKQHIQAIIDAVDKDNVECLGYLPW
GCIDLYSASGDRDKRYGFIFVDYEDGLKRYRKDSFYWYQKVIESNGKELEGESACTLFL

Enzyme Prediction     

No EC number prediction in MGYG000001396_03339.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	466	1.4e-134	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	4.85e-170	1	472	4	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	1.43e-145	3	470	6	474	cryptic 6-phospho-beta-glucosidase; Provisional
pfam00232	Glyco_hydro_1	2.14e-141	3	466	7	452	Glycosyl hydrolase family 1.
PRK09593	arb	1.05e-131	3	470	8	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	6.30e-126	3	469	6	476	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX08277.1	0.0	1	479	1	479
VED97473.1	1.95e-188	1	469	1	456
AMK55261.1	3.55e-129	1	472	21	494
QPS13317.1	3.75e-129	1	470	3	474
QQY27863.1	3.75e-129	1	470	3	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	6.61e-116	3	469	10	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.05e-111	1	469	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.97e-111	1	469	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	4.32e-111	3	470	13	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	9.12e-110	1	469	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	7.97e-124	3	470	6	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	4.04e-118	3	470	9	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P11988	9.36e-116	3	470	6	463	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
P26206	1.60e-115	5	469	9	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q48409	5.56e-113	3	470	6	463	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001396_03339.