CAZyme Information: MGYG000001397_00057

Basic Information

• Species: Dialister succinatiphilus
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister succinatiphilus
• CAZyme ID: MGYG000001397_00057
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	MGYG000001397_1|CGC2	59597.38	9.0575

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001397	2457839	Isolate	not provided	not provided

• Gene Location: Start: 51461; End: 53050 Strand: -

Full Sequence      

MKLNKNCIFLFLFCIVLYGAFLGTIPLLDPDEPVYGETAKEMIATGDFLSPRIYGEFWYD
KPPLFYWLEALSFSLFGVSTWAARFPSLFLGALTPVYLYLSSRKLIGGKAALRGAFICAT
SLEIIVLARSSVTDTLLTLTLTITLMSFLRKEYIAAYIFCGLALLTKGPVGFGFPALIVG
IWMVLTKQFHVKEILGLKWYWGIPLACLIGLPWYIAMGHIHGSAFIDTFLGYHNVTRFVS
PEHAGQNHYWLYIVVLLAGFYPWSGTLPGIFRRTKKWLKDRTSAFFLVWTLFIFIFFSLS
STQLFSYVLPMFPPLSLLAGMYLTDCEESGHISKTLIFSHLFFSLLTAGAIALAPINPDG
GPIIRWLIVFFMVLAAVLAALGLKRGRFRAFMMTQALLILVFVLSIWGAFASAVSSLFTS
AAIAEKLASTDRDPSIPLYVDTFYRPSTAFYTDIYGKALPEFDRRKQETDEKNEEKGVLL
PGKETSRLPENAYILVQKKVFKNWPEEQKSGLTVLWEKDTALLLLKKED

Enzyme Prediction     

No EC number prediction in MGYG000001397_00057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	455	5.7e-115	0.8703703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.88e-47	8	362	11	379	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.16e-38	1	363	2	376	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.30e-14	60	182	1	131	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.52e-13	6	216	1	233	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24580.1	5.19e-283	1	526	1	527
AOH39317.1	5.96e-204	4	527	6	528
ALG41392.1	6.99e-105	21	457	25	461
AVO73979.1	5.50e-104	21	457	25	461
CCC72524.1	5.50e-104	21	457	25	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.47e-28	27	386	54	434	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	9.48e-33	15	382	13	381	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
C5BDQ8	2.24e-32	27	363	27	375	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q2NRV9	2.99e-32	27	355	27	364	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT2 PE=3 SV=1
A1JPM4	5.69e-32	1	332	1	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
A0KGY4	5.05e-30	12	330	10	337	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999994	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
80	102
111	133
153	186
199	221
249	271
283	300
304	323
336	356
361	383
396	418