CAZyme Information: MGYG000001397_00292

Basic Information

• Species: Dialister succinatiphilus
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister succinatiphilus
• CAZyme ID: MGYG000001397_00292
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000001397_1|CGC4	39729.76	8.4203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001397	2457839	Isolate	not provided	not provided

• Gene Location: Start: 349462; End: 350535 Strand: +

Full Sequence      

MEEKHYQVDLTNKTIVLIYMLYFGDMVSISPFLEVLRREAKGSRIILVMDARFQESVKYN
PNVDEIIPFDRHGKEKGMAATWKLGKKIGKLHPDILLTLHGTTRSTLLALAMGPKHWGGE
EGTRIDSFFMDWPMTIETYNSHAVDKYLKVLERLGVKDLHHSGMRTFTSPEWDRKARAFY
ESRGIQPGDRLAGFSVGSSTAEKNWPAEKYGQVADHFAKKGLIPVFFGVPSEIPLIEKAV
SAMESKRYIVAAGKLSMGEFMAAAGRCSLAFTNDSGPMYVFDSRGVPTIAMFGPSNAKFH
HPLGPCSKALSSWDMPMGPEHVNKTIASGNYTPISEITTEEVIAAGEEALTKSEKMK

Enzyme Prediction     

No EC number prediction in MGYG000001397_00292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	82	310	1.1e-39	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	7.61e-49	14	345	1	274	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	7.71e-40	13	354	2	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	3.03e-25	82	316	2	235	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	6.69e-11	9	353	2	346	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	1.25e-05	193	354	184	347	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25206.1	1.80e-190	7	356	7	357
AXL20515.1	7.84e-89	8	352	2	344
ALG42175.1	4.16e-86	8	352	2	344
AVO27634.1	4.16e-86	8	352	2	344
CCC73399.1	4.16e-86	8	352	2	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	8.84e-72	9	353	5	348	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37