CAZyme Information: MGYG000001397_01722

Basic Information

• Species: Dialister succinatiphilus
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister succinatiphilus
• CAZyme ID: MGYG000001397_01722
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		38234.74	8.6242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001397	2457839	Isolate	not provided	not provided

• Gene Location: Start: 679109; End: 680110 Strand: +

Full Sequence      

MRILICQLRNHGDIIRCFPLIDAIKAIYKDAFIGFTCFPEMIETCALCHNIDVVIAQPRF
KSVTDTQDETRVLDCSILEDAVAEARKYNFDLYIDLHGVFQSALFGAICGIRTRLGRSKE
TAKDGASLFYTVIAEVKEKELNRMERHFIITRKILKNVKPVYIQVKKKDYITIFPGSSKK
GILKRWSTDRYIKIANKYRDKYYVRMVLGPEESDLVRYIRNRIDIDIVECNSWEKISELI
SESGIVIGNDGAFVHLAVWKGIPSIMICGPLSPVVNGIWKYGIGQTISVPKHCICNYLWQ
GKCDYNHYCIDKITVADVIKAVSRLEIYLNERI

Enzyme Prediction     

No EC number prediction in MGYG000001397_01722.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	82	310	2e-28	0.9688888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.68e-33	2	324	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.15e-28	1	325	2	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.27e-12	86	303	9	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	0.002	2	33	7	38	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEM20987.1	8.85e-123	1	323	1	324
QTA79811.1	1.62e-63	41	324	1	290
BBB33584.1	4.19e-26	2	325	12	352
AGB42275.1	1.77e-24	2	324	434	776
ACL70637.1	1.30e-21	1	325	434	775

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001397_01722.