CAZyme Information: MGYG000001398_02460

Basic Information

• Species: Longicatena caecimuris
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Longicatena; Longicatena caecimuris
• CAZyme ID: MGYG000001398_02460
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487	MGYG000001398_2|CGC2	57085.41	5.1112

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001398	3065798	Isolate	not provided	not provided

• Gene Location: Start: 357485; End: 358948 Strand: +

Full Sequence      

MRTFPEGFLWGGATAANQMEGGWNEGGKGWSVSDCARAKFDVDVKNYEKQNEITSKDIEE
ALAHPEDMVNYPKRHGNDFYHHYKEDIKLFAEMGFKVFRMSIAWSRIFPNGDDETPNEEG
LQFYDDVFDELKKYNIEPLVTMSHYEPPLNLTLSYDGWYSREVIGFFENYVRTICERYKN
KVKYWLTFNEVDSIIRHPYTTGGLIKDRFPNKNFEEVCYQAMHHQFVASALATKICHEII
PGAKVGCMITKLSYYPMTCKPEDILKSQQMMRNIYAYSDTQVFGEYPSYLLSYYKNHDIH
IHKEAGDDEIMKKYPVDFVSFSYYMSSCVAEDETGIEKTAGNTVMGLKNPYLPSSEWGWQ
IDPIGLRISLVELYDRYRKPLFIVENGLGAKDELIDGKVHDEYRIDYYRKHFKCMLDAIL
EDGVELMGYTSWACIDLISESTKQMSKRYGFIYVDVDDYGNGTYDRYRKDSFYWYQKVIH
HNSLDFE

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	483	4.6e-141	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	1	487	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	482	1	453	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	487	3	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	1	482	1	472	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.29e-178	3	482	5	473	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCT46149.1	0.0	1	487	1	487
ASU17417.1	6.62e-314	1	487	1	487
QQR25969.1	6.62e-314	1	487	1	487
ANU70164.1	6.62e-314	1	487	1	487
AWH76101.1	1.72e-307	1	487	1	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	9.48e-181	2	483	6	466	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	1.65e-173	1	483	17	482	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	6.17e-164	3	483	7	476	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.17e-156	1	485	4	479	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.32e-156	1	485	4	479	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	8.40e-184	2	483	6	466	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.11e-182	3	487	6	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	1.54e-170	1	487	1	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q48409	1.90e-166	1	483	1	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46829	3.38e-163	3	483	7	476	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001398_02460.