CAZyme Information: MGYG000001398_02734

Basic Information

• Species: Longicatena caecimuris
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Longicatena; Longicatena caecimuris
• CAZyme ID: MGYG000001398_02734
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000001398_3|CGC1	56355.96	6.4353

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001398	3065798	Isolate	not provided	not provided

• Gene Location: Start: 121611; End: 123071 Strand: +

Full Sequence      

MKKSVFREDFYWGGATASNQCEGAWKQDGKGESCADHFTVGKVDSPRRFTKEIEEGSIYP
SHFAVNHYNQYEEDIKLFAEMGFKMYRLSINWTRIFPNGDDQKPNQKGLDHYRSVLELCR
KYGIEPLVTMSHYEFPYHLTKKWNGWEDRRTIDCFVTYTKTIMEEYKDLVTYWLTFNEIN
TPLMGGGVTMSLGMMPKEEKLFFGKGDKITPNDANLIVNGMHHQFIASAKTVIEGRKINP
NFKFGCMIASNVVYPYTCKPEDVMKAWEVQQRTNYYCGDVMVRGEYAPFTKSYLKDLQAT
IHTLPEDDAILKEGVVDYYAFSYYMSGCGTADKEILEKNKSIFSTAKNPYLKASEWGWQI
DPEGLRYYLNETYNRYKVPLMVVENGLGANDKLENDTVHDSYRIDYLRQHIQAMAKAVED
GVDILAYTMWGCIDIVSASTGEMKKRYGFIYVDMDDRGKGTLKRYKKDSFYWFKKVIQSN
GEDLSD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	481	1.3e-142	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	4	484	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	485	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	3	485	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	485	1	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	9.12e-168	1	484	1	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCT43677.1	0.0	1	486	1	486
QLY79850.1	7.75e-213	6	484	3	480
BCJ92912.1	4.45e-212	6	485	3	481
QOV20995.1	6.45e-202	1	484	1	490
APX72002.1	1.17e-200	4	486	3	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	6.89e-163	6	484	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	2.80e-157	4	484	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	7.97e-157	4	484	5	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	8.82e-156	1	484	3	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3QOM_A	1.61e-151	1	484	6	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	1.31e-158	6	484	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	2.13e-156	6	484	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	5.05e-156	4	484	2	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46829	4.83e-155	1	484	3	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	9.69e-155	8	484	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001398_02734.