CAZyme Information: MGYG000001399_00207

Basic Information

• Species: Odoribacter laneus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter laneus
• CAZyme ID: MGYG000001399_00207
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	MGYG000001399_1|CGC3	73920.4	5.5272

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001399	3753471	Isolate	not provided	Asia

• Gene Location: Start: 213521; End: 215437 Strand: +

Full Sequence      

MNKILWIGWAVLSLVSCRPGEIPKSEKAFEYPDILNITYTPDHSKGGKGWYTDCGAWMGF
TLPEAEKFTNGFCGPFDLDNRRWISRSLVQVGYVENGKIITPDMFHPDSLVYFPGQLYME
SSIATISIRQRLFFTDKNHALLLCQSDEEIDWFFEGSIWGEDYKNEVINQSLVIYLPRGE
VAAVTFEKDAEIMLTSSVYKASFSKLARHHIAVFSFFNKQEELQQGLEKAEALLGQSQHL
QEQHAQRWNTYLERILRTDMPASYNQIAVKAMVTLLSNWRSSKGDLLHDGMVPSHAVGYF
VGFWAWDTWKQAVATVRFEPELAKNQIRSMFDYQDEAGMIADCIYSDKRENNYRDSKPPL
AAWSVYEVFRETADTAFVREMYPKLLKYYRWWFSYRDHNGNGICEFGSTDGTEEAAKWES
GMDNAVRFDEAKMVKNREGAWSFNQESVDLNAYLSYEHRLLKQMAALVGERFEEPDRTEN
LKTYFFDEEKGYFFDKVLEGDFVRVEGPEGWTPLWTEIATSEQAGRVMKILADTNKFSTY
IPFPTLAADHPKFLPGGYWRGPIWLDQVYFGISGIRKYGYHRQADYYTDQVFTRLKGLSG
KAPIHENYDTHDGSVLKAPHFSWSAAHLLMLYWEYGRK

Enzyme Prediction     

No EC number prediction in MGYG000001399_00207.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	211	635	2.6e-104	0.5298245614035088

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.05e-131	12	638	14	786	alpha-glucosidase; Provisional
COG3408	GDB1	8.98e-17	320	632	302	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	1.59e-10	356	613	178	479	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	1.35e-08	356	531	203	434	alpha,alpha-trehalase
pfam12958	DUF3847	0.007	219	258	1	39	Protein of unknown function (DUF3847). A family of uncharacterized proteins found by clustering human gut metagenomic sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY39153.1	6.65e-250	2	637	6	644
ABR39053.1	6.65e-250	2	637	6	644
QJR62245.1	1.89e-249	16	637	21	644
QJR74523.1	1.89e-249	16	637	21	644
QJR66502.1	1.89e-249	16	637	21	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	5.17e-80	28	638	2	759	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.69e-79	28	638	2	759	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.74e-79	28	638	2	759	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	7.35e-76	28	638	3	760	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	8.66e-36	28	421	328	779	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	4.33e-79	28	638	25	782	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.32e-17	296	626	90	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.09e-17	296	626	90	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000663	0.968619	0.030036	0.000247	0.000212	0.000199

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001399_00207.