CAZyme Information: MGYG000001399_01592

Basic Information

• Species: Odoribacter laneus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter laneus
• CAZyme ID: MGYG000001399_01592
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840	MGYG000001399_1|CGC19	95839.63	7.0322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001399	3753471	Isolate	not provided	Asia

• Gene Location: Start: 1902546; End: 1905068 Strand: +

Full Sequence      

MYIRFFLLCFFLLSYFVGNSADISIFPTPQKVIFTGKTFSLEGTFWIKEKNTDPYLRQLL
SEILPLQKEKKGRSPRIYIGQIKDPQIKKFRAQIPEISGGYYLSVRPETIIIAGFDQRGL
FYALQTLRQLRQGNRLAEADITDFPTVLYRGVVEGFYGQPWSHEDRLRQLRFYGNFKLNT
YIYGPKDDPYHSSPNWRIPYPEKEARQISALVEEAKANQVDFIWAIHPGQDIQWNDADRQ
ALLKKFEDMYRLGVRSFAVFFDDISGEGTDPVRQAELLNFLHDRFVAAKPDVTPLIMCPT
EYNKSWSNPKPGSYLDILGENLYPSILVMWTGDRVISDITASGLEEVNQRIRRPAYVWWN
FPVNDYVRDHLLMGPAYGLDASAGEKMSGFVANPMEKAEASKIAIFGVADYAWNPAKYDS
EKAWEKAIQVLMPNASEALHTFAAHNSDLGPNGHKYRREESVNINPEIRKFLTAFRKGDM
PAESLSKIRTEYQKILTACTQLSTTPENPDLIREISPWLMQFEVLGKAGLAATELAALSP
RQELCRYWDTYSALIGYENERLRIDKSYNQNPYQPGIKTGSLVMQPFIDSVRLLSEQLFW
KEETEPAPKEASVPRLYTNIEQIKSLPLQKDSNRISLTPMLEVIRIAPQQYLGIAFPYPM
HSAQLEANLNASVSKWGRLEISANGSDWIPCRVTPQGTVFTAALPDSIPFQYVRFINFGP
AQKEIYLKKYSLSSPQLSELKNSVAFLSDKQLQTACILMPAQSAVIENPHKGVNKRYCLL
TILPPQAALEIKGKTKDNQFPFLGTADKNCYTFECPAEIEEIHISNPTQQPISLYELLEK

Enzyme Prediction     

No EC number prediction in MGYG000001399_01592.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	150	443	2.3e-112	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	2.84e-171	150	442	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	4.24e-15	22	143	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam18344	CBM32	7.78e-09	616	668	12	64	Carbohydrate binding module family 32. This domain is found in GH84C present in Clostridium perfringens. GH84C is a beta-N-acetylglucosaminidase. This domain is a family 32 carbohydrate binding module (CBM) which preferentially recognizes the non-reducing terminus of N-acetyllactosamine.
COG3525	Chb	2.29e-04	98	204	205	316	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO26212.1	7.52e-252	4	733	5	736
AUI48059.1	1.51e-251	4	733	5	736
QJR56515.1	4.00e-251	22	733	21	734
AII68140.1	4.00e-251	22	733	21	734
QJR58687.1	4.00e-251	22	733	21	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7K41_A	7.32e-243	18	733	1	715	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2J4G_A	2.92e-241	22	733	1	711	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	3.02e-241	22	733	2	712	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2JIW_A	3.02e-241	22	733	2	712	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2VVN_A	6.19e-241	22	733	23	733	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	3.39e-240	22	733	23	733	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	1.80e-95	27	502	48	539	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	2.49e-95	27	502	48	539	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	5.35e-53	25	708	41	762	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	5.66e-39	151	411	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000444	0.998893	0.000171	0.000151	0.000147	0.000149

TMHMM  Annotations     

start	end
5	27