CAZyme Information: MGYG000001399_01970

Basic Information

• Species: Odoribacter laneus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter laneus
• CAZyme ID: MGYG000001399_01970
• CAZy Family: GH110
• CAZyme Description: Alpha-1,3-galactosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		65764.99	6.5588

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001399	3753471	Isolate	not provided	Asia

• Gene Location: Start: 2347563; End: 2349302 Strand: -

Full Sequence      

MKKIAGIWLYYLVGSILISCSTGQQAEEKVVYLKDYLVGYQEGQDATLALRRALDECKKV
KARRLELPAEKLYFQPDYAVEQYVFVSNNDEGLKRFAFDLTGLSDIVLEGNGAVLLFSGF
VCPFLIREAENIEVRNLSIDYTRTFHSEGKIEACGEGWLDVSFASEYPYYFSNGCLHFKD
NQGNKYPYSNLLEFDVEKREPAYMVKDYWLSGGCMPAQELKNGNVRIFKDKIKGTPGNIL
VFGAAQRLIPAFTVTDSKRVRIQHVNIWHCGGMGVIAQRSGDIELDHVQVTPSPGTGRMI
SITADATHFSNCYGFIRMLNCLFENQKDDATNIHGIYAVIDSIIGPQELIVKLMHPAQEG
FDFIRPGQQLELVNHKSLIQYGELSVENVERLNKKYTRVCLTAPLPEGTRVKDVVAAMGP
YPEVLIRACKMRNNRARGLLLGSRGKIRIEKNYFHVPGAAILFEGDGSYWYEQSGVRDVV
IRENVFDNCNYGIWGKACIAVGSGIYEQRETSRYHRKIRVEENTFHIFDPRLVNLYGVDD
FVFKGNRIIHTDAYSYQGQEQRPFVIDNCSNIFIQETED

Enzyme Prediction     

No EC number prediction in MGYG000001399_01970.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH110	30	576	2.3e-149	0.9963503649635036

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	0.002	423	575	10	130	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL12596.1	7.73e-230	26	578	23	577
BBL09802.1	7.73e-230	26	578	23	577
BBL01922.1	9.23e-229	26	578	23	577
QUR44558.1	3.42e-217	1	575	1	572
ALJ40196.1	3.42e-217	1	575	1	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7JW4_A	7.42e-153	26	574	23	592	Crystalstructure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta],7JW4_B Crystal structure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta]
7JWF_A	4.19e-152	26	574	23	592	Crystalstructure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_B Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_C Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_D Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1KD83	1.27e-105	15	575	17	578	Alpha-1,3-galactosidase A OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=glaA PE=3 SV=1
Q89ZX0	5.55e-75	26	578	23	583	Alpha-1,3-galactosidase B OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=glaB PE=3 SV=1
B2UNU8	4.35e-71	22	578	210	768	Alpha-1,3-galactosidase B OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=glaB PE=3 SV=1
Q5L7M8	2.91e-65	1	577	1	579	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=glaA PE=3 SV=1
Q64MU6	2.93e-64	1	577	1	579	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=glaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000005	1.000055	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001399_01970.