CAZyme Information: MGYG000001399_02950

Basic Information

• Species: Odoribacter laneus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter laneus
• CAZyme ID: MGYG000001399_02950
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000001399_3|CGC2	43818.28	9.6733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001399	3753471	Isolate	not provided	Asia

• Gene Location: Start: 127219; End: 128361 Strand: -

Full Sequence      

MKYYIISGEASGDLHASNLMKGLKRNDEQAQFRGWGGDMMREAGCEIVRHYKDTAIMGFL
TVLKNLGKIKENIRLCCKDITEWQPDVLILVDYAGFNLRVAKFAKSAGFTVFYYISPKLW
AWNTGRVKKIKKYVDRMYVIFPFEKEFYQKYNYPVDYEGNPLVDAIALRPHQAERFSEFI
TCYQLPDKPIIALLAGSRSQELKHVLPKMLCMTRHFPDYQFIIAGAPSMTEEDYEPYLKG
MNVPVIYGQTYRLLKQSRAALVTSGTATLETAILKTPQVVCYSGEGGAFSYLLFKLFVKV
RYISLVNLIMGQEVVKELLMQQLNEKNIKKELQQILPEGPVRQKMLKNYEELNRRLGEPG
ASERFARQIVKDLRFILGKK

Enzyme Prediction     

No EC number prediction in MGYG000001399_02950.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	2.6e-117	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.24e-118	1	371	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.97e-107	1	373	2	378	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.12e-82	4	370	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.78e-70	5	373	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.59e-47	52	369	46	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY31424.1	5.72e-198	1	378	1	378
SNV26174.1	5.72e-198	1	378	1	378
AZS31618.1	1.56e-195	1	373	1	373
QRO51639.1	4.45e-195	1	373	1	373
BAX81022.1	7.84e-150	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.13e-46	5	371	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.77e-46	5	371	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	6.12e-72	5	380	11	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	5.17e-70	5	366	11	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q1D393	2.25e-68	5	373	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
A9KC41	4.06e-67	5	375	8	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J161	5.72e-67	5	369	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001399_02950.