CAZyme Information: MGYG000001400_01777

Basic Information

• Species: Erysipelatoclostridium ramosum
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium ramosum
• CAZyme ID: MGYG000001400_01777
• CAZy Family: CE1
• CAZyme Description: putative protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275	MGYG000001400_2|CGC3	31445.77	4.5953

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001400	3785853	Isolate	not provided	not provided

• Gene Location: Start: 128260; End: 129087 Strand: -

Full Sequence      

MALVQVNFISQSLKRTVSMNVILPVDKFLFKGNCQPVKEYETLYLLHGLLGNYTDWVTRT
RIQEWAEAKNLVVVMPSGDNSFYVDQEVKNNDFGIFIGTELIEVTRRMFHLSNRRDDTFI
AGLSMGGFGALRNGLKYYQNFGYIAALSSALNIFELPVHDESRCVMGEDSCFGDIDEAYL
SDKNPKICLENLIQAKKEDNTIVFPKIYMACGCDDELIGVNRKFKGYLENAGFDLVYKED
VGSHNWDFWNKYIQDVLEWLPLDPYEEGINSGNVK

Enzyme Prediction     

No EC number prediction in MGYG000001400_01777.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	10	260	3.3e-48	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.35e-28	42	261	56	309	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	4.16e-14	10	249	1	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	8.19e-11	10	261	75	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PRK10439	PRK10439	1.80e-05	90	260	262	406	enterobactin/ferric enterobactin esterase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNI36504.1	2.48e-15	38	262	177	382
AEU34816.1	7.86e-15	40	249	164	358
AJP74243.1	8.87e-15	32	255	183	389
QHN04822.1	1.46e-14	33	260	161	372
ADF53787.1	1.95e-14	6	260	159	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	1.43e-51	1	264	2	265	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
4ROT_A	2.72e-36	1	267	8	264	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
7L0A_A	2.02e-33	1	263	9	261	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
2UZ0_A	4.17e-33	2	263	6	255	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]
6VH9_A	6.80e-33	2	263	4	255	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.29e-73	1	260	1	261	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P0C1D7	2.80e-11	14	249	117	371	Protein PS1 OS=Corynebacterium melassecola OX=41643 GN=csp1 PE=4 SV=1
P9WM38	2.50e-10	19	244	190	425	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	2.50e-10	19	244	190	425	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1
P0C1D6	2.98e-10	14	249	117	371	Protein PS1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=csp1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001400_01777.