CAZyme Information: MGYG000001400_02526

Basic Information

• Species: Erysipelatoclostridium ramosum
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium ramosum
• CAZyme ID: MGYG000001400_02526
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000001400_2|CGC18	56684.43	5.3362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001400	3785853	Isolate	not provided	not provided

• Gene Location: Start: 900246; End: 901676 Strand: -

Full Sequence      

MKKLYRLPEGFKFGSSASAWQTEGWTGKKEHQRNFVDMMYLAEPERWFNGVGTIKSTDFY
NRYEEDIKLMKELGIQVYRTSIDWSRFITDYETNEVDQDALRFYEKVIDCLIENGIEPML
CLEHWEIPEYVINKYGTWDNRKVMELFVGYSKKVMAAFHDKIKYWWTINEPAVVPNEAYL
FGNIWPYEENTKKSVQMNYHRVLATSLLVEHHAKMGYQGKVGIILNPSPSYPKSMNNPKD
IEAAKICDMFNYKQYTDPLINGKFDEAYFELLKKHECMFEYVKGDFEKIDDNKIEVVGIN
YYQPLRVRQRETAWNPDKPFIPTAYYETYSPRGIKMNFSRGWEIYPKGIYDMLKIIQNDY
RNIECWITENGMGVMDEDKFKDASGQIQDSYRIEFLSDHMAWMLKAIDEGCDCRGFLNWT
FTDNLSPVNAFRNRYGFVEIDMENNRNRRIKKSGDWVKELMRTRCFEAEDTEPEYK

Enzyme Prediction     

No EC number prediction in MGYG000001400_02526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	464	2.1e-118	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	2.42e-153	4	469	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	2.68e-111	6	466	4	453	Glycosyl hydrolase family 1.
PRK13511	PRK13511	2.47e-85	5	464	3	466	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	4.91e-60	7	463	4	471	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.28e-52	1	461	1	470	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY27725.1	0.0	1	476	1	476
QPS13466.1	0.0	1	476	1	476
QMW73277.1	0.0	1	476	1	476
QQV05284.1	0.0	1	476	1	476
AQR96801.1	3.27e-190	2	476	5	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NAV_A	2.76e-110	3	460	16	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	5.51e-110	3	460	16	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5FOO_A	1.20e-106	4	460	1	456	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
4B3K_A	1.65e-106	7	460	3	455	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
6Z1H_A	1.91e-86	3	469	7	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	1.02e-137	5	460	7	459	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P26208	1.02e-70	7	466	6	448	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
Q08638	1.47e-69	6	467	5	445	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P22073	1.54e-69	4	468	3	446	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1
P42403	6.77e-68	7	463	9	472	Aryl-phospho-beta-D-glucosidase BglC OS=Bacillus subtilis (strain 168) OX=224308 GN=bglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001400_02526.