CAZyme Information: MGYG000001400_02935

Basic Information

• Species: Erysipelatoclostridium ramosum
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium ramosum
• CAZyme ID: MGYG000001400_02935
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000001400_2|CGC27	54853.06	5.0619

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001400	3785853	Isolate	not provided	not provided

• Gene Location: Start: 1340595; End: 1342013 Strand: +

Full Sequence      

MKEEFLWGGALSNVQAEGAYLEDGKGLNVYDTLVVTPEPGIEPMFCDTKVATDHYHHYQE
DIDYMAQMGYKAYRFSVVWSRIHPLGNEESPNEAGLAYYEKMVDYLLSKGIEPVVSLVHF
DMPDYLLKNYNGFMNKEVINFYARHVEAVVSRLKGKVKYWLTYNEINLAYCQSDLVAGAY
LPDGMSKAEMFVQLNINVQIAHARAVEVIKRVDPQAKVGGMIGHAPFYPLTCKSSDIIAA
DFKNKLHNYFAFDTMCQGELPDYFKQYALNRNITISLNKADEEVIKSASTKLDYLAFSYY
RSSVQASFDEIDDVITLEDAILFDQRNLKNPYYQANEWGWQIDSQGLRYSLIDFYHRYHK
PLFIVENGIGIDEQLIDQKVYDDQRIDYYQQHIKAIKQAVEHDGVDLIGYLAWSPIDFLS
SHKEIRKRYGFVYVDRDFEDLKDLKRYPKKSFYWYKKCIATNGDDLENNIEY

Enzyme Prediction     

No EC number prediction in MGYG000001400_02935.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	463	7.5e-132	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	4.31e-167	1	467	4	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	5.21e-139	3	467	8	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	1.23e-138	1	466	4	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	4.28e-132	3	467	6	474	cryptic 6-phospho-beta-glucosidase; Provisional
pfam00232	Glyco_hydro_1	2.84e-126	3	463	7	452	Glycosyl hydrolase family 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY27346.1	0.0	1	472	1	472
QPS13834.1	0.0	1	472	1	472
QMW75828.1	0.0	1	472	1	472
QQV05702.1	0.0	1	472	1	472
QQV04539.1	1.80e-285	1	472	1	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	7.63e-127	3	466	10	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	6.30e-123	1	466	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.78e-122	1	466	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.82e-119	1	466	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
2XHY_A	1.14e-114	1	466	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	7.60e-124	3	466	10	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	1.21e-119	1	466	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	2.83e-119	3	467	9	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	4.82e-118	3	467	6	463	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P24240	3.78e-114	3	467	6	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001400_02935.