CAZyme Information: MGYG000001402_00912

Basic Information

• Species: Coprobacillus cateniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Coprobacillus; Coprobacillus cateniformis
• CAZyme ID: MGYG000001402_00912
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738	MGYG000001402_1|CGC7	85188.91	4.9126

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001402	3861289	Isolate	not provided	not provided

• Gene Location: Start: 878363; End: 880579 Strand: -

Full Sequence      

MKGSDRDYGKDDSLYYQDKRNIIVFNEFLINSIEKTYLYIATLGYSIITINNQRITEDEL
NLVWTQFQKCVYYDVYDVTQYLHVGNNEISIELGNGMYNPSPLKLFGKYNLRERLKEVGE
PRVICDLITNEDVILSTDASWKMKEGQFLFNNLYLGEKIDLHKLDSEIKPVFVDGTKRHM
QLNTIPPIRKKQTVQPKQYISTNEGLVVDFGEMISGFIDIEFYAQDHTHVILQYSEKFEN
NQMDYHTCLAGSVGEQIQDITVPGGLGAPVMAIQKDEIIACAGKNSYTNTFTYHSFRYVL
IQGIGQEDIDTLSAIYVHTDLKQIGTIGTDNAVLNELYDVALRTKLNNVHGIFEDCARER
LGYGGDMVALATSNLYTFDLEELYKKIIRDFRYEQTKNGGIPETAPYMGIQSNGTGEGEG
PLLWQLVYPYLTYKHYQYYGDIKVLEEEYPYLYKQMQYLLNYDLDKLVHCCLGDHGSMLI
AGQFRKPTPDKLFLGYCTLLLFLKYNILTAQIINEDMSQYQKKYDELKLHIIHQFQNKDG
TFGEGTQTGFAFAIALQLTSPELLCQKLVEKIEQDQGIFNSGIFGMALTYEVLNSYGYNE
IIERWLLQESNVGYLAMLKNGNRALAELFVGEQLSLNHAMFSSYTQWYYQGLAGIQICED
AVGFDKIKLSPYFSKQINHFECTIETNQGMITSSWQRNQDEIVWKIEVPRTIQYQIKFNQ
DYQIVNQNNQMIIHIRKL

Enzyme Prediction     

No EC number prediction in MGYG000001402_00912.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	203	716	2.7e-103	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.70e-41	322	652	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.80e-24	33	192	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.10e-06	202	303	3	86	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	7.29e-05	654	709	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQV04787.1	0.0	1	735	13	751
QQY28243.1	0.0	1	735	13	751
AUI71217.1	2.38e-239	7	716	21	732
CBL51046.1	2.04e-212	7	716	15	726
AGF56675.1	4.82e-202	15	709	116	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.14e-50	33	709	189	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	9.38e-34	33	709	316	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.32e-33	32	695	139	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.55e-52	15	720	186	908	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.22e-39	32	729	178	889	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	1.90e-33	29	721	183	881	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	5.07e-33	33	709	316	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999881	0.000122	0.000002	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001402_00912.