CAZyme Information: MGYG000001402_02181

Basic Information

• Species: Coprobacillus cateniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Coprobacillus; Coprobacillus cateniformis
• CAZyme ID: MGYG000001402_02181
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000001402_1|CGC36	56387.87	6.6387

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001402	3861289	Isolate	not provided	not provided

• Gene Location: Start: 2206628; End: 2208079 Strand: +

Full Sequence      

MDNNTFAFPSHFLWGGATAACQIEGAYNVDGRGLSTSDIHKYDTGLDRKKYRHKLVENEH
TSATLSAAIADKEGYYPKRFGNGFYYRYKEDIALMKELGLNSFRFSISWSRIFPKGDELE
PNQKGLEFYDRVINEVINAGMEPIVTMFHYDIPLHLLTQYGGFKNPKLIEFMTRYARVLL
NRYGDRVKYWIPFNQTNLIQYCSFKSLGILRDQTDNLVEDQYRAIHNQFLINAKIKKYAK
SLNSHIEIGIMLADCTYYPRTCKPQDIVFAMKRIRMQYFYADVPLRGEYPGHMLRYFNEN
NIRIDISEEDKSLLKENTLDFLAFSYYYSRTLDSQKNTMDPATISENPYLKSNDWGWTID
PLGLYNAISQYWDRYQKPIMIAENGFGYEDVFEDGVVHDDYRIDYLRQHILVVGEAIKDG
VNVFAYLPWGPIDLVSSGTAEMSKRYGFVYVDLDDYGRGTGERFKKDSFYWYQKVIASHG
TIL

Enzyme Prediction     

No EC number prediction in MGYG000001402_02181.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	480	1.3e-136	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	7	482	3	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	4.63e-173	8	480	4	473	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	2.11e-172	8	483	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	1.04e-168	7	481	5	475	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	3.04e-145	8	483	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYK62200.1	2.98e-219	8	483	8	481
APB71184.1	8.52e-219	8	483	8	481
CBK89201.1	6.71e-218	8	483	8	481
QIX10523.1	2.72e-217	12	483	12	481
QCI86620.1	1.81e-215	8	483	8	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	4.32e-158	1	483	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.05e-148	2	480	1	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.97e-148	2	480	1	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	6.25e-145	2	480	1	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
4IPL_A	1.45e-142	8	483	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	3.35e-157	1	483	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	5.08e-150	8	483	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P26206	7.35e-145	8	483	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q48409	8.11e-144	8	483	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46130	8.81e-143	7	483	6	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999533	0.000491	0.000014	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001402_02181.