CAZyme Information: MGYG000001404_00380

Basic Information

• Species: Paenibacillus_L senegalensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_L; Paenibacillus_L senegalensis
• CAZyme ID: MGYG000001404_00380
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227	MGYG000001404_1|CGC3	25641.41	8.1373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001404	5495033	Isolate	not provided	not provided

• Gene Location: Start: 413755; End: 414438 Strand: -

Full Sequence      

MALLQVNFFSYILGMDSSMTVLLPEKRQQPYQSNPNKKYPVLYLLHGHSDDHTSWQRKSL
IELLVRDHDLIVVMPNAHRSFYTNGKHGHRYFDFFAHELPVVVGNFFPASDKREDNFIAG
LSMGGYGALKLALNFPEKFAAVGSLSGAMSPIDALIKADKNGMFTVTDFTENFKNVFGTK
EEYQHTESDLFYVTGKLDKKIHPSPESINPAGKVTLCTKRILHTVIL

Enzyme Prediction     

No EC number prediction in MGYG000001404_00380.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	12	175	7.1e-42	0.6167400881057269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	3.62e-37	13	151	22	189	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	2.52e-25	15	168	4	164	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	2.34e-15	8	149	73	212	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	1.21e-09	9	154	24	183	S-formylglutathione hydrolase
COG0596	MhpC	1.31e-06	40	161	22	135	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHW58811.1	7.71e-13	5	195	132	311
QKZ14156.1	1.13e-12	31	181	158	326
BBE20344.1	1.54e-12	5	175	146	313
QNT67597.1	2.12e-12	31	203	419	613
AZA12550.1	2.18e-12	31	172	174	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	2.11e-49	1	212	2	213	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
4ROT_A	1.71e-33	1	149	8	156	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
7L0A_A	5.69e-33	1	213	9	211	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	1.93e-32	2	213	4	205	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
2UZ0_A	5.29e-30	2	200	6	196	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.13e-22	1	202	1	192	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
Q8FKG2	2.73e-12	9	151	20	174	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=frmB PE=3 SV=1
Q0TKS8	2.73e-12	9	151	20	174	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=frmB PE=3 SV=1
P51025	9.62e-12	9	151	20	174	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain K12) OX=83333 GN=frmB PE=1 SV=2
Q1RFI8	9.62e-12	9	151	20	174	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999915	0.000129	0.000005	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001404_00380.