CAZyme Information: MGYG000001404_01475

Basic Information

• Species: Paenibacillus_L senegalensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_L; Paenibacillus_L senegalensis
• CAZyme ID: MGYG000001404_01475
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1034	MGYG000001404_2|CGC9	114460.92	4.6505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001404	5495033	Isolate	not provided	not provided

• Gene Location: Start: 872033; End: 875137 Strand: +

Full Sequence      

MRSVFTHPAVRNTFYYTWKTIKWTLILIIVAGFGAAGIAFGFTTSLVKDEPVRSKEEILA
KIEENAITGFVYFNNDTQIGQLRSDEDRRLVEYHEIPQSVLDAVLAVEDANFFNHIGVDV
NGLFRAVKERLLNEERQTGGSTLTQQLAKIVFLSPEKELDRKAKEIFLSVRMERMLSKEQ
ILTAYLNKVPFGTGANGYNVFGIKAAAKGIFGIENLAELNIAQSAYLAGLPQLPSAYSAF
KSNGDFDETGFKRAEDRKERVLRRMLEVEKITEAEYQQALAFDIRSSMAEPEVKAYTTYP
NLMIEVEKRAAEVLVSVFEPEIYENRSANPEAYSEAYKDALQELSRGGYKVYTTIDQTIY
DAMQEIANEDSHFLPDDPEAGIEQVGAIMLDNKTGAIIGMIEGRRTSFNHATQAYRQPGS
AMKPIAAFLPAMEKGAIQPAGVIDDTPIILKHGNSGYHIPENWNRRFHGLITAREALNQS
YNIPAIKLFLNEVGIEEAWAFAQELGINSFTQEDYHAQTGVIGGLTKGVSVEELTNAYTA
IANQGKFNDAHLIRKIETTEGELIYENEPLSKQVFSAETAYLMTDMMRTVITSGTGSDIR
SLFKNYGKIPVVGKTGSTQEDTDAWFVGYSPDITVGVWVGYSDQKYKLSARNGSTKHAMK
VWSLVMDSAIEKKPELFTTTEFERPADIVEMTVSNLSGKLPNDLVRQQGRLVSDLFNRKY
VPTEEDDVLVKMKYVIYNGVNYLPHESTPADMLWEKTVINRPESIGSILQQIQEVMGSIP
PNRQRALSAYVPRDADMDAPSVTDPRTDDGQPPQPPADLVMTRSGDTNTISFSPSPSSDV
VGYRLYRSDGLNNFQRVQGQVVRVGEENVFSGVPYSFGSGYYVTAVDVAGNESSPSRIVF
NDSINPDLILPGNGGNGSNSEDEDGNGAGNGNESGNGNGNGNGSSENGSKPAAPRGLKVE
EKGQALRFTWNGQGNSDQYHVYYSTSEQGPYQRIGSSDEQEFVYYGTELEGYYRVTAVKN
SEESPASPAVRYEP

Enzyme Prediction     

No EC number prediction in MGYG000001404_01475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	78	265	1.5e-55	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	6.45e-162	10	698	3	623	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.40e-160	87	672	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	9.71e-139	19	751	3	791	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	1.78e-86	79	698	136	705	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
TIGR02073	PBP_1c	1.64e-83	71	796	13	661	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFH64363.2	0.0	17	1031	33	1054
AEI42445.1	0.0	17	1031	33	1054
ALS21524.1	0.0	16	1033	20	1024
QAV20250.1	0.0	3	1032	6	1023
QGQ96973.1	0.0	3	1032	13	1030

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JE5_A	3.89e-89	36	701	2	665	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
3DWK_A	8.40e-73	64	703	3	618	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.56e-69	60	703	9	627	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
7U4H_A	7.90e-68	47	762	2	846	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3UDF_A	1.51e-61	91	681	42	727	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40750	9.06e-77	19	640	6	596	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
P39793	1.02e-74	19	693	35	661	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
A7GHV1	1.27e-74	19	785	9	763	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A7FY32	3.42e-74	19	785	9	763	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	3.42e-74	19	785	9	763	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999973	0.000065	0.000000	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
21	43