CAZyme Information: MGYG000001404_03402

Basic Information

• Species: Paenibacillus_L senegalensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_L; Paenibacillus_L senegalensis
• CAZyme ID: MGYG000001404_03402
• CAZy Family: GH163
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1527	MGYG000001404_4|CGC3	166797.62	4.1683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001404	5495033	Isolate	not provided	not provided

• Gene Location: Start: 430553; End: 435136 Strand: -

Full Sequence      

MNLNAGDLLVEEGEPRADIIIRSDASNMERYAAEELQSTIKMVSGAELPIHQRSEFDSHT
VNVNLDKSELALQKGGNYPFSVNFVNGEAVARTVKVEPAPGNPFTVALNEGFTLQPGQGG
SVTGAVYVPSATVDGEYNLLLQPYIDDAAMDQQLTLKINLNQNMLINPGFDSSITEGWYS
TSAVHDTEVKRQGEASLRLDSANVRSNQPLNIEPGKKYKLKAWMKGEKTGIARLQVYEMR
NPYALYNSVGINAAVTTEWSPFELEYTRDPSSEFDYNWIVISFQGHNGPGKLWIDDVELV
EIAGDEGPSGPPAPGPISSEDQLQIVLATMEGLSDDSQMHELYGGHLKDSDGFAIHRSGN
RVYILGDDPRGVLNGVYDFLEENAGVLWTRASEKGTLYEPLENIALMKTDYWEKSPLKVR
GWLTAGVSVDGEAHSDYATEVMLARNKNNAKMSAHGSNQRHWDRFINTGVKPIMLGHNLN
FWLPNSEFFDEHPEYYNTDSEGNHIPLSDKTQINFYHEDLPGVFAEKAKNLIASTGIEYV
GIGINDNSSFYQKGYTDNPFTTEDGVVVQPEDPAYLSTVFFTFLNKVAREVKETYPDAKV
VAYAYTFTDTPPKLELEDNIVIVYAPLYEDAREPINTTNTSNANYRYNEKLKAWAEKTKN
ILVYNYYGSFPSSAYERPIAEKVKADMQYYRDLGILGVLPEGTLDSGNEGWGVNALQFWL
MNRLFWNPDEDIEELKTQFIEKAYGAAAGPMREYYDLIEQGWNYDNAQQTWTVSGETLVR
QYIVVAGIKDEAQAALDAAYAVADEKARARIAPIKETFERMVEAVGDSVGISAEAVRTTY
TKEQIMSTLDFSSGPWASVKEPITNFKHMQTQAEPLVETKVYLLWDDENLYVGYENFDPD
VSKIRTSPDAPNEWWRNGDDDSVETYLADGTRGTNVYYALMSNSNALNLDYIGPEQSPAW
NGVWESVAEVKEDRWNIIQVIPFSTLNFMTPYPEMTIMGHFFRNYHRTGSGLGLYGWAGG
AVWSPADFKPIKLVEDDGEPGDGEPGDGEPGDGEPGDGEPGDGEPGDGEPGDGEPGDGEP
GDGEPGDGEPGDGEPGDGEPGDGEPGDGEPGDGEPGDGEPGDDEPGDGGSGDGDSGAGAP
GGGAPAPQPDAQPSPTAGDQQIVTASELNPQRGKVTIELEEGKSVLLLPLNTAELLKGGV
LSVIKASVALELPAALLEEWLEAAKVSSDSEGQIAVSLETRKPSQANLGNAVPNGANVVV
QPIGEIVRLEWAVIDDMGEKHAYHSFSHPIKLEFTIGDRDASLLGIYRLAPGGKTEYVGG
ARSGDKFVVELTQIGDYVLLEWKQSYADVPQGHWAEEAIRTLSAKHVVNGMTATDFAPSG
TLTRAQFAALVVRAYGIKAERDSLQLFADVQPDAWYAEAAHAAAASGVVNGMGDNSFMPD
EPVTREQMAVMLVRAQEAKYGSLGEGKPLTDYSDTEKVSNWALRALQIAVDKGWLQGKAD
NLLDPGDTATRAESAMLLYKILGPQYR

Enzyme Prediction     

No EC number prediction in MGYG000001404_03402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH163	483	755	2.9e-66	0.9920318725099602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16126	DUF4838	5.07e-44	476	755	2	263	Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.
cd09618	CBM9_like_2	7.27e-13	856	1009	22	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
NF033190	inl_like_NEAT_1	1.04e-12	1346	1519	582	749	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
NF033190	inl_like_NEAT_1	3.74e-08	1340	1455	637	751	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
cd09620	CBM9_like_3	3.10e-06	856	1025	10	186	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY71258.1	0.0	8	1035	48	1068
QNK60258.1	3.40e-303	9	1033	427	1444
QJD84461.1	6.64e-302	9	1033	488	1661
QTH43592.1	1.25e-301	9	1033	470	1647
BBH18867.1	8.78e-294	8	1033	450	1634

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	1.13e-30	1250	1522	1577	1855	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38535	3.53e-25	1353	1522	914	1081	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
C6CRV0	5.69e-21	1328	1521	1265	1458	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P19424	5.75e-19	1346	1526	41	222	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
P38537	6.72e-15	1354	1522	42	206	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001404_03402.