CAZyme Information: MGYG000001405_03286

Basic Information

• Species: Ferdinandcohnia timonensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_L; Ferdinandcohnia; Ferdinandcohnia timonensis
• CAZyme ID: MGYG000001405_03286
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		39187.27	5.0799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001405	4608762	Isolate	not provided	not provided

• Gene Location: Start: 539057; End: 540058 Strand: -

Full Sequence      

MTKQVEIPSLYKKYEPYFDIGAAVNVKTIHTQKNLLCSQFNSFTAENEMKPELLQPEEGL
YTFESADQIVTFARENEKNLRGHTLVWHNQTPNWFFEDKDGQVADKYTVLKRMRDHIHTV
VTRYKKDIYCWDVVNEVINDEGPELLRKSKWLDIIGPEFIERAFEYAHEADPNALLFYND
YNESNPEKREKIYTLVKSLIEKGIPIHGIGLQAHWNLTQPSTDEIRAAIEKYASLGLKLQ
LTELDISAFTFENRRTDLLSPTAEILEQQADRYDRLFQLLREYKEVITAVTFWGAADDYT
WLDNFPVAGRKNWPFLFDENHKPKDSFWKVIQF

Enzyme Prediction     

EC	3.2.1.8	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	11	332	2.2e-114	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	1.00e-131	49	330	1	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	3.62e-130	10	330	4	308	Glycosyl hydrolase family 10.
COG3693	XynA	6.26e-103	40	333	58	340	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFE82288.1	2.84e-174	4	333	5	329
ACP87343.1	6.66e-170	6	333	8	335
AWB46206.1	6.66e-170	8	330	9	331
ACW01971.1	6.66e-170	6	333	8	335
ACW01926.1	2.70e-169	7	333	10	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1N82_A	4.95e-158	7	331	5	329	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
2Q8X_A	7.02e-158	7	331	5	329	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MUI_A	4.04e-157	7	331	5	329	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUI_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MS8_A	5.74e-157	7	331	5	329	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MS8_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
6WQW_A	1.82e-156	10	332	6	328	ChainA, Beta-xylanase [Thermobacillus composti]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45703	1.72e-148	7	331	5	328	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
O69231	1.35e-143	6	331	4	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P23556	7.29e-124	9	333	16	342	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
Q12603	3.86e-121	2	333	27	352	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P10474	6.73e-103	7	332	42	371	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001405_03286.