CAZyme Information: MGYG000001405_03820

Basic Information

• Species: Ferdinandcohnia timonensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_L; Ferdinandcohnia; Ferdinandcohnia timonensis
• CAZyme ID: MGYG000001405_03820
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
977	MGYG000001405_4|CGC2	108855.44	6.6248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001405	4608762	Isolate	not provided	not provided

• Gene Location: Start: 407524; End: 410457 Strand: +

Full Sequence      

MNFNKRQIFEKIGSLWKSITMNKVVRAIAGKKARKGVRVTYGVVWNLFLIFFIVAILGFG
FAGGAGAGYFASLVKDEPIRSYDSLKKDIYNYEENTEVYFANEVYLGQLRSDLQREEVAL
KDISQYVKDAVIATEDQYFYKHDGVVPKSILRAIVQDVTNSPIQTGGSTLTQQLIKNQIL
SNEVSFDRKAKEILIALRLEKFFDKDEILEAYLNIVPYGRNSSGRNIAGVQTAAKGIFGV
DAKDLNLPQAAYIAGIPQNPYTYTPFLNQGGKVKENLEPGINRMKTVLERMLTGGFITQK
QYEEALAYDIRANLVPPKSEPTEKYPWLINEVEKRATDILMRKLAKEDGYEEKDLEENKD
LRIHYHEIADRNLRQNGYKVYTTIDKEVHDVLQEATKNFQYFGPDRKETKKNLETNEDVV
VMEPEELGSVLIENQTGKIIGFVAGRDFEREQTNHAMGSVRPNGSTMKPLLDYAPAMELG
LTQPGSVIADVKFSYGKYTPQNVGGKYDFDGLMSARRALQISKNIPAIKTYLKAFDQRPI
TFLEKMGFTSLDERDYSAPSLAIGGMTYGVSVEENVNAFATFANEGKFIDAYMIEKIVTN
DGDVVFEHESKPVDVFSPQTAYLTIDMMRDVINGGTASSLKGYLKFNADWAGKTGTTNYY
EDIWFVATNPNVTFGTWMGYDTPKSVEKTYKGLNYSRRNILLWSQLMNAVYDVKPDLVKP
KENFKMPGGIVSRSYCGISGLLPSDLCREAGLVQSDIFNAKYVPTKVDDNLVKGKYIEVN
GKAYRVPASAPQEFVQQGIMIKKEFLEEHGLKDSSAIEQLLPNNNRWSKLVITESSELKD
NGSVPSQVKGASISSGTLKWAKHEHNDVIGYRIYAAANFTTDFKKIGSVPATKNLQFKVG
NAAAAYYITAVDVTGKETPLANSVLIKSGDYKPEPEVVTPPPAPQAPPADGGKPEGNGNN
NEKENNGNGNGKENGGN

Enzyme Prediction     

No EC number prediction in MGYG000001405_03820.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	108	291	9.1e-58	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	4.32e-166	95	709	55	595	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.10e-154	114	711	1	529	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	3.43e-117	81	749	36	752	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.30e-77	115	679	58	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.85e-69	102	292	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR65857.1	0.0	31	940	22	927
APH04063.1	0.0	31	934	16	918
QNF26513.1	0.0	31	935	18	921
QNG60914.1	0.0	32	932	17	912
QGQ47539.1	0.0	35	949	20	927

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JE5_A	1.92e-120	64	754	3	676	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
3DWK_A	1.07e-67	98	744	10	608	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	4.07e-63	98	744	19	617	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
7U4H_A	4.23e-56	74	797	2	839	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
2FFF_B	5.50e-54	344	754	19	411	OpenForm of a Class A Transpeptidase Domain [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	7.55e-80	30	805	2	734	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	7.55e-80	30	805	2	734	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	3.51e-79	30	805	2	734	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
P38050	3.13e-76	115	722	67	609	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P40750	6.35e-72	87	711	48	624	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999870	0.000163	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
41	63