CAZyme Information: MGYG000001407_01720

Basic Information

• Species: Clostridium_J senegalense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_J; Clostridium_J senegalense
• CAZyme ID: MGYG000001407_01720
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219		25981.1	10.2034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001407	3871298	Isolate	not provided	not provided

• Gene Location: Start: 199138; End: 199797 Strand: -

Full Sequence      

MAQAGRWNLLKLCTIPGTNFVIKRSILKRLGGWDEKAISEDTEISFRIYKIGYKIAFMPL
AVTWEQEPETIRVWFKQRTRWAKGNIYVLNKYLIKIFREKPSKILFDVMYFFLVYFLFLS
SVLISDGIFILSIFTNLKTSINGNLNILWILAYILFILEVAITLTMEKGQGTFKNVILIP
IMYFTYCQMWLIVAVNSFIQYIKDIVLKREVKWYKTERF

Enzyme Prediction     

No EC number prediction in MGYG000001407_01720.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	12	150	5.1e-23	0.5939086294416244

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	8.74e-23	1	193	200	392	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	1.12e-18	17	89	162	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06427	CESA_like_2	1.37e-16	6	84	154	229	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
pfam13632	Glyco_trans_2_3	3.24e-16	14	131	71	187	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
PRK11204	PRK11204	8.49e-16	11	137	205	330	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACA57087.1	1.40e-107	1	219	202	420
AKJ89327.1	1.98e-107	1	219	202	420
AKC62034.1	1.98e-107	1	219	202	420
AVQ52631.1	1.98e-107	1	219	202	420
AVP59564.1	1.98e-107	1	219	202	420

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.51e-78	1	219	196	414	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q5HCN1	2.77e-11	14	100	200	286	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6G608	2.77e-11	14	100	200	286	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q6GDD8	2.77e-11	14	100	200	286	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	2.77e-11	14	100	200	286	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
111	133
145	167
177	199