CAZyme Information: MGYG000001407_02785

Basic Information

• Species: Clostridium_J senegalense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_J; Clostridium_J senegalense
• CAZyme ID: MGYG000001407_02785
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1143	MGYG000001407_4|CGC1	130129.32	6.8862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001407	3871298	Isolate	not provided	not provided

• Gene Location: Start: 96159; End: 99590 Strand: -

Full Sequence      

MKSFVKFLIIQLLFIGFTLGNSINVYANEVKQKELYILEDPTWLRQTGFSKGLGHDRQDL
GIILPANVQLTIKQVNPNFKGNLTLRLLNDNNKHETSRNFNQTQITVSVPYSSVPFVDTI
YNGTEKPKIEYTISNNMQTLPIYKKGQNQQDFFSQWDRTSAPFALVVDDYFQLLVPQKDK
AFMKRMRDFSSIDELILYYRDIFTYYNKLSGISFDTNIKTNKNIPNKYFIKADISGPGGG
YYGGNHTAETSDSVASFWLSKGWGALHEIGHGYQDNFTRGEVWNNIYAHSFQQKNLGSGI
YSNGWLYDYGRKNIVDSNIDNLLHKNQSAFNTWGLREQLYGFILLKNKAGDDSFTHFNQE
YRKLANSNGFNISDYNQFDLLSKAYGEISKLDFTPVIESFKGKMSDWQKELNRYQNYKPV
AILNEVVPTSKVSEIQKTLNLETPLSLVTTDDLARTGLTGNVTLNIKIDDFNQIKNQTIY
LMNGEKEVKKVSITSPSISLGQLPIGIYTIYSTNTNNKCYTLDTHYLKVKESNNNVTLNY
KLRTKSVLLNQEIEFLGLGDDKFASAHVDLENQHLNIEVTSKDPHSYFPNEQYGKIEILD
TNGNITYSKVMNGTNTTLEHSSQILKEGYKIRLYHAEPSRLKIKNNKTTLTNNKTNTLVV
TSQGLKNENLSQNLNQELATSIDTFASKIYENKLLSQSNCAESKVELKLTINSLTEPLKT
QMLTKYKELLKENPTTNEDESEGSAFSFDFKGYSDRLFAKLNLDLENLNGKLTVENIMPH
YYFKDSYASILIQDKNGSTIFSRDFIGSETNNNSVEDIPLQEGYYITIKHREHSNRLFVN
NDTKNISLNKNAVNSYKIMKNKLESINESDIPNPSKNPYLGEKFNITFKGLGDWIFAELN
LDLASKQANIDIKKGEPHVYFTDSYTSVAIKDAEGNDVYTKDFIGNKGNDALVKDIPLKT
GYYLAIKHKEPNNRLIITNTINKLELDKDTIITYKITDTGLVKSSEDEIPIPSNPIYYGN
EFNTVFKGYADRAFAEMNMNLTENQATINISDGIVHSYFSDIYTSILIQNSKKETVYSKN
FIGTNNYSKNSETVNLEEGSLITLTHLESSNRLEIINKETQFSLPKSNSVTYQVVDGGLK
KIN

Enzyme Prediction     

No EC number prediction in MGYG000001407_02785.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03272	Mucin_bdg	9.11e-30	887	1001	1	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
pfam03272	Mucin_bdg	1.06e-25	749	863	1	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
pfam03272	Mucin_bdg	4.57e-25	555	665	2	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
pfam03272	Mucin_bdg	4.21e-14	1025	1139	1	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
pfam13402	Peptidase_M60	1.69e-06	141	401	6	268	Peptidase M60, enhancin and enhancin-like. This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity. It includes the viral enhancins as well as enhancin-like peptidases from bacterial species. Enhancins are a class of metalloproteases found in some baculoviruses that enhance viral infection by degrading the peritrophic membrane (PM) of the insect midgut. Bacterial enhancins are found to be cytotoxic when compared to viral enhancin, however, suggesting that the bacterial enhancins do not enhance infection in the same way as viral enhancin. Bacterial enhancins may have evolved a distinct biochemical function. These bacterial domains are peptidases targetting host glycoproteins and thus probably play an important role in successful colonisation of both vertebrate mucosal surfaces and the invertebrate digestive tract by both mutualistic and pathogenic microbes. This family has been augmented by a merge with the sequences in the Enhancin Pfam family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ39155.1	0.0	1	1023	1	1024
AVQ44128.1	0.0	1	1023	1	1024
AJD32461.1	0.0	1	1010	1	1010
ARC86396.1	0.0	1	1010	1	1010
AUM99413.1	0.0	1	1024	1	887

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29998	4.99e-36	41	837	13	836	Viral-enhancing factor OS=Trichoplusia ni granulosis virus OX=10462 GN=VEF PE=4 SV=1
P41723	8.70e-36	41	837	13	836	Viral-enhancing factor OS=Pseudalatia unipuncta granulosis virus OX=36355 GN=VEF PE=3 SV=1
P54232	1.68e-27	41	837	13	835	Viral-enhancing factor OS=Heliothis armigera granulosis virus OX=45440 GN=VEF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001158	0.997423	0.000741	0.000216	0.000222	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001407_02785.