CAZyme Information: MGYG000001408_00753

Basic Information

• Species: Brevibacterium senegalense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Brevibacteriaceae; Brevibacterium; Brevibacterium senegalense
• CAZyme ID: MGYG000001408_00753
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277	MGYG000001408_2|CGC1	29359.54	4.2317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001408	3398887	Isolate	not provided	not provided

• Gene Location: Start: 151775; End: 152608 Strand: -

Full Sequence      

MRPARVFATVIASLLVVAMGVGLWALMSYLSLAPSPMKTPSIAEADHGSAAGAPDRPTPP
LVAGGARPADRIVGDDGLEEVRPAAEGSPASAYAVDPDWAGETAERTGIPQRVMESYAAA
ALWAQDEHPRCGVEWNTLAGVGWVESHHGWLHGASVRADGDVRPKIIGVPLDGTGGTALV
RDTDGGRLDGDTEFDRAVGPMQFIPETWEMFAVDARGTGEADPHHIDDAVFSAANYFCSM
GVDFASDEGWNRGILRYNASQEYADDVYAAAQYYAEA

Enzyme Prediction     

No EC number prediction in MGYG000001408_00753.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	127	273	3.7e-19	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2951	MltB	6.70e-21	25	260	15	259	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	5.37e-18	131	267	1	102	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13406	SLT_2	6.30e-06	197	253	155	204	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS35761.1	1.12e-64	99	275	51	232
AYJ34261.1	4.51e-64	99	275	51	232
BBF99786.1	8.90e-64	83	275	50	250
SDU80958.1	1.67e-63	54	277	31	254
QOD94959.1	2.15e-62	1	277	1	255

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000005	0.000001	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
7	29