CAZyme Information: MGYG000001410_01773

Basic Information

• Species: Sutterella wadsworthensis_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella wadsworthensis_A
• CAZyme ID: MGYG000001410_01773
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	MGYG000001410_6|CGC3	32502.44	6.8577

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001410	2665472	Isolate	not provided	not provided

• Gene Location: Start: 103559; End: 104467 Strand: +

Full Sequence      

MTFRKQPRQFRISHLVSVSVLALTLGGAAFWSDSDYASTAPALSYAQEDLNARADLRQRE
GVLSGVTPSLSLLDAPAAAREEATASSEELTVEDNVIHEGSPRHLVAEYISRTFRVSMRD
ARQITDWAVEIGEARDLDPLLILAVIGTESSFKPTARSNAGAEGLMQVMTSVHEAKFDAF
GGPEAAFDPYANMVVGTDILSYLIRRTGSVRRALKWYSGAANLEDDRGYGARVMREHGLL
TVAAEGRTDAAVKLHRAGKSASEGGAGNAAKLGFAHWTKLSERTEGAPRARNADLRGKAQ
AS

Enzyme Prediction     

No EC number prediction in MGYG000001410_01773.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	135	235	1.1e-17	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	8.55e-19	139	236	1	98	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	8.30e-18	123	235	7	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.34e-15	133	235	15	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	6.34e-14	130	229	3	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13400	LT_IagB-like	2.96e-11	136	235	2	105	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22549.1	3.82e-57	106	260	74	228
QDA55116.1	6.65e-54	106	281	102	279
QQS89286.1	1.83e-53	106	282	86	263
QKO22158.1	7.34e-40	42	247	36	238
QTD43912.1	4.93e-39	40	248	43	242

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27380	8.56e-08	127	240	7	122	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
O31976	4.20e-07	136	218	1434	1512	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	4.20e-07	136	218	1434	1512	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.549504	0.329062	0.119181	0.000641	0.000375	0.001228

TMHMM  Annotations     

start	end
12	31