CAZyme Information: MGYG000001411_00084

Basic Information

• Species: Pauljensenia sp000308055
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp000308055
• CAZyme ID: MGYG000001411_00084
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767	MGYG000001411_3|CGC3	80636.77	4.9007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001411	1864179	Isolate	not provided	not provided

• Gene Location: Start: 98973; End: 101276 Strand: -

Full Sequence      

MLHAKNRTLVTTLATLSLMGMPIVAYADPAGGETPGSDAETVSPAPETVTTAPEEAASLP
TAEASQAPGEDRAAPTLVSIGDIQTPGDGDDSHLINQTVETKGVVTAAYPKGENANLKGL
EGFTIQTPGTGGTWDPTRSTSDGLFVFMGKSSASMPSIGDCVVVKGKVAEYAGVKNETAS
TQSLTQLLPQAITAVSGCDPVKPTEVSGVPTRDQMEALESMLVLPKDTWTITDNYKTNRY
GTLSLTPGTEVLRTATDVVAPGTAAQAYEAENAAKTIDLDDASTTDLTNFKQNGHKERYA
YLANGAPARVGYHVTFTKPVVLESRFGSFVFQPTQMTAGYPDRSPVAIRGERPAVPTVSG
DTKVATFNVLNYFSDLGENEPGCKGYEDRNHKYVTDKNCKLRGAWSSLAFANQQTKIVQA
INTIDADVVALEEIENPVASGVSSDRDGALKSLVNALNAAAGSEVWAYVPSPSTVPANED
VIRIAFIYKKAKIAPVGDSVIYDDPAYTGLARQPLAQEFKPITDANHEGKNFVVIANHFK
SKGSAPKNLSGAEAAANTDNGDGQGNSNGVRVKQARALATFAQSFNGTPTLLVGDFNAYS
KEDPLKVLTDAGWTHESGHGDSSYVYGGRSGSMDHVFANSAAHPLITEVKSWAVNAQESI
AFEYSRANYNAYLAFEADNPYRASDHNPEIIGLNLITPINNPSVAPTSEPSGQASTSPNA
PTQPTPQSAATPKHSTLASTGVMGSIPLIAGALALAAIGCALRRKTL

Enzyme Prediction     

No EC number prediction in MGYG000001411_00084.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033681	ExeM_NucH_DNase	0.0	101	695	1	545	ExeM/NucH family extracellular endonuclease.
COG2374	COG2374	4.78e-125	35	695	155	788	Predicted extracellular nuclease [General function prediction only].
NF033680	exonuc_ExeM-GG	1.42e-55	61	715	181	865	extracellular exonuclease ExeM. ExeM, as described in Shewanella oneidensis, is a biofilm formation-associated exonuclease that cleaves extracellular DNA (eDNA), a biofilm component. Members of the ExeM family contain two or three pairs of Cys residues, presumed to form disulfide bonds, and a C-terminal GlyGly-CTERM membrane-anchoring segment. Strangely, engineered removal of the GlyGly-CTERM region did not result in net export from the cell and appearance of the enzyme in culture supernatants.
cd10283	MnuA_DNase1-like	3.32e-51	363	688	2	261	Mycoplasma pulmonis MnuA nuclease-like. This subfamily includes Mycoplasma pulmonis MnuA, a membrane-associated nuclease related to Deoxyribonuclease 1 (DNase1 or DNase I, EC 3.1.21.1). The in vivo role of MnuA is as yet undetermined. This subfamily belongs to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds.
cd04486	YhcR_OBF_like	7.13e-13	101	195	2	74	YhcR_OBF_like: A subfamily of OB-fold domains similar to the OB folds of Bacillus subtilis YhcR. YhcR is a sugar-nonspecific nuclease, which is active in the presence of Ca2+ and Mn2+. It cleaves RNA endonucleolytically, producing 3'-monophosphate nucleosides. YhcR appears to be the major Ca2+ activated nuclease of B. subtilis. YhcR may be localized in the cell wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDS92078.1	1.51e-130	78	695	239	829
ANC31565.1	1.23e-127	76	696	237	840
QAY71724.1	3.67e-123	84	693	241	838
QAY64865.1	6.07e-121	84	693	250	845
QAY73698.1	6.61e-121	78	700	298	907

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000365	0.998782	0.000256	0.000230	0.000186	0.000153

TMHMM  Annotations     

start	end
740	762