CAZyme Information: MGYG000001412_01447

Basic Information

• Species: Robertmurraya massiliosenegalensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Robertmurraya; Robertmurraya massiliosenegalensis
• CAZyme ID: MGYG000001412_01447
• CAZy Family: GT0
• CAZyme Description: UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		36952.49	5.9251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001412	4895985	Isolate	not provided	not provided

• Gene Location: Start: 251262; End: 252245 Strand: -

Full Sequence      

MDILIRADASVEIGSGHVMRCLTIAEAMKKKGHQVTFFMEVLPGDLTSVVEGKGYPVVRN
MQSTDICIIDHYQIDEEWEKYICPHVKKIVVIDDLANRRHECDVLIDQNVVPNFESRYDL
LVPNDCKKLLGPNYLIMRDEFIAVRVKQRERTGEIKNLLVFMGGTDPTNETMKVLKALKK
TNHSFEVIHVVVGNGNVHKEEIRTICAIQHYEYHCQIDYMAKLMNEVDFSIGAGGSTTWE
RCYVGLPSSSTIVADNQITATETAAKLGAVINLGWHEDVSVESYMNLLHSLPKRKEELLS
ISQKGLSLTESQGEPNAWISYILELRS

Enzyme Prediction     

No EC number prediction in MGYG000001412_01447.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03590	PseG	2.73e-86	3	262	2	277	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
COG3980	SpsG	1.50e-69	1	303	1	305	Spore coat polysaccharide biosynthesis protein SpsG, predicted glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	1.18e-09	16	248	11	275	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	1.57e-07	137	317	163	343	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	1.20e-05	138	248	164	275	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXH98456.1	5.95e-143	2	325	3	323
QPA30690.1	2.22e-138	1	325	1	345
AKP48481.1	5.16e-137	1	325	1	345
QCR31520.1	1.08e-136	3	325	4	325
QTB23152.1	2.41e-131	1	325	1	317

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58462	3.35e-27	1	247	1	264	Uncharacterized protein MJ1062 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1062 PE=1 SV=1
P39627	3.57e-17	1	313	1	323	Spore coat polysaccharide biosynthesis protein SpsG OS=Bacillus subtilis (strain 168) OX=224308 GN=spsG PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001412_01447.