CAZyme Information: MGYG000001412_03239

Basic Information

• Species: Robertmurraya massiliosenegalensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Robertmurraya; Robertmurraya massiliosenegalensis
• CAZyme ID: MGYG000001412_03239
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		61132.81	5.6128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001412	4895985	Isolate	not provided	not provided

• Gene Location: Start: 64908; End: 66512 Strand: -

Full Sequence      

MSKQEIMNKNGVTVEKDVSWQIKIVNERLRDDETARIPSKKAGVNALELSMEDHSRKDKT
NILIAASEGAPFFVTGGLGEVIGSLPKAIMKEDSHQFDIRVVLPLYETIRPEDRSQLQFL
GHFDVSLSWRKQYCGVFKMEKNGVIYYFIDNEFYFRRTVPYGYGDDGERFAFFSKAVLES
IHLMDFKPAIVHCHDWQTALIPVYLHFTHHDLQLKSLFTIHNIEYQGISDLSMIEDIIGL
QKEAVGILEYRGAVNLMKAAIETAHQVNTVSPNYASELRYDYFAKGLASIIQRNEHKMVG
ILNGIDTEIYDPKTDSAIFTNYDKDSIDKKKENKIQLQKLVNLPIDEKAPLIAIVSRLVS
HKGLDLITSMMEKLMNEHVQVVVLGIGERKYEDYFRWLHEQYQGKVASLISFNQDLARKI
YAGADFFLMPSQSEPCGLAQMIALRYGTIPIVHAVGGLRDTISDCSTGEGNGFVFEQYNG
DDLFDAITRGLNAYRNEENWNALVKWVMNLDYSWEKSAKEYEKLYVDLNEIYVM

Enzyme Prediction     

No EC number prediction in MGYG000001412_03239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	61	525	1.5e-166	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	61	525	1	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	0.0	61	525	2	475	Glycogen synthase [Carbohydrate transport and metabolism].
PRK00654	glgA	0.0	61	525	2	460	glycogen synthase GlgA.
TIGR02095	glgA	0.0	61	528	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	1.38e-109	62	528	6	479	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS77673.1	1.13e-159	62	525	3	472
ADU27513.1	2.11e-158	62	525	3	467
AYF42051.1	2.11e-158	62	525	3	467
QCN92806.1	2.11e-158	62	525	3	467
AYF39227.1	2.11e-158	62	525	3	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QZS_A	6.30e-84	62	528	3	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	4.86e-83	62	528	3	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
3D1J_A	1.09e-82	62	528	3	476	ChainA, Glycogen synthase [Escherichia coli]
6GNE_A	6.36e-73	66	525	16	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
1RZU_A	4.27e-70	61	528	2	475	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q18A79	6.97e-144	62	528	3	478	Glycogen synthase OS=Clostridioides difficile (strain 630) OX=272563 GN=glgA PE=3 SV=1
A4J4I4	9.01e-142	62	528	3	474	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
Q6HC18	1.80e-140	61	530	2	476	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2
Q81K85	1.80e-140	61	530	2	476	Glycogen synthase OS=Bacillus anthracis OX=1392 GN=glgA PE=3 SV=1
B9J2G5	2.55e-140	61	530	2	476	Glycogen synthase OS=Bacillus cereus (strain Q1) OX=361100 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001412_03239.