CAZyme Information: MGYG000001413_01370

Basic Information

• Species: Enorma massiliensis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Enorma; Enorma massiliensis
• CAZyme ID: MGYG000001413_01370
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
195	MGYG000001413_1|CGC9	21825.67	4.222

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001413	2263023	Isolate	not provided	not provided

• Gene Location: Start: 1598384; End: 1598971 Strand: -

Full Sequence      

MSALRAFGWFRVIPLCLVLLFGLISFGYTSAPSLLLRPFYPLEYQDYISKASARYSVDPY
LVAAVIECESNWNSEAESYRGAQGLMQLMPDTASDMVRLGLVDGSEYDPEDLSDAETNIM
FGCAYLRYLIDYFNGSTDYAIAAYNAGLSNVEEWASAATALHNAITFPETQAYLIRVKNA
HKRYQELYAGTFEGM

Enzyme Prediction     

No EC number prediction in MGYG000001413_01370.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	184	1.4e-28	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.52e-59	41	183	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.16e-41	40	177	2	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.87e-37	59	182	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.89e-29	48	154	1	102	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	3.80e-27	40	190	135	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69985.1	9.03e-80	1	192	1	192
ATP53198.1	1.28e-79	1	192	1	192
QIA32839.1	1.05e-78	1	192	1	192
QWT18301.1	9.10e-64	22	193	2	173
AEB06732.1	1.73e-63	8	192	9	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	1.10e-18	40	190	449	603	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	9.40e-18	40	190	449	603	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
6FBT_A	6.13e-10	40	177	445	585	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	6.21e-10	40	177	474	614	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	1.52e-09	40	177	445	585	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64046	2.86e-18	40	177	1418	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	2.86e-18	40	177	1418	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P0AGC4	5.21e-17	40	190	476	630	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	5.21e-17	40	190	476	630	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O31608	9.12e-17	48	181	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997013	0.002441	0.000084	0.000018	0.000010	0.000439

TMHMM  Annotations     

start	end
7	29