CAZyme Information: MGYG000001415_02371

Basic Information

• Species: Alistipes communis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes communis
• CAZyme ID: MGYG000001415_02371
• CAZy Family: GH123
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		55394.91	4.8037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001415	3134723	Isolate	not provided	not provided

• Gene Location: Start: 702784; End: 704262 Strand: -

Full Sequence      

MKSYLSSLLLSVGLFLLLVSCNSGTVRKISSFDELPDPTADTLSDWSGVPQGLHASFVST
DAVFRRSVAPDVAPSASAQLEGWRGERVSAQLLLWTASGADGVEVKVEPFRSDGHTLSED
VAQARFVRYVLSDEFGNKCGYHDPTIYPPHLVPDMLDDIDVFDIKARNVRPVWITISVPA
DTPAGEYVSTVKLFAKGQQLQTFDIELTVIGRELPPPAEWNYYLDLWQHPAAVARIEGLD
MWSDAHFEALVPYMQLLADAGQKVVTTTLNKDPWNNQCFDSYADMIIWTKKADGSWSYDY
TVFDRWVELMMDLGIDHTINCYSMLPWNNELHYRDDVTGCFADVTADPGTPAFEELWVPF
LTDFTGHLREKGWLGRTNIAMDERSPEEMTDALDLLRKTAPELGIAMADNKNSYLSYPFV
NSVCVKVCDRVPPQHIAGRRAQGFVTTYYVCCSDRLSQHVHFFRPCRSGLCRMVYGCLRL
RRFFALGLQFVG

Enzyme Prediction     

No EC number prediction in MGYG000001415_02371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH123	51	455	7.6e-143	0.7546468401486989

CDD Domains     

MGYG000001415_02371 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL03317.1	0.0	1	468	1	468
BBL07500.1	5.46e-314	1	468	1	468
SCM55400.1	1.15e-189	19	468	24	474
BBD46967.1	1.98e-187	19	455	32	469
SCD18916.1	1.15e-186	16	468	21	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L7V_A	8.18e-109	32	468	6	446	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7V_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5L7R_A	1.25e-108	32	468	21	461	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7R_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_A Chain A, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_B Chain B, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5FQE_A	4.96e-51	83	454	62	451	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQE_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FR0_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5FQG_A	6.58e-50	83	454	62	451	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQH_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000025	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001415_02371.