CAZyme Information: MGYG000001416_00239

Basic Information

• Species: Cellulomonas massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas massiliensis
• CAZyme ID: MGYG000001416_00239
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000001416_1|CGC6	38291.12	6.4611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001416	3245988	Isolate	not provided	not provided

• Gene Location: Start: 274694; End: 275803 Strand: +

Full Sequence      

MSRKSLLASLAALAVAAAVIVPFASSASAATCAAAWSSSAVYTGGQSASYNGRNYLARWW
TQNETPGRAEVWTDQGTCTGGSGGGTGGGTGGGGTGGGTTCTAATWTAGTWYTAGTVVRY
TDGKYYVAEHDNPGYDPLISTWYWDPTTCSGTGGGTGGGGGSTSGFVVSEAQFNQMFPSR
NGFYTYQGLVAALSAYPQFASAGGATIAKQEAAAFLANVDHETGGLVYIREINTANYPHY
CDTSQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLRNPYLVEQDSAVAWKTAL
WYWNTQSGPGTMTPHAAMVNQRGFGETIRSINGSIECNGGNPAQVQSRVAKYQQFTSLLG
VAPGGNLSC

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	167	369	7.7e-72	0.9653679653679653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	1.29e-81	168	369	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	7.63e-56	167	369	1	232	Chitinase class I.
COG3179	COG3179	1.02e-09	168	305	4	164	Predicted chitinase [General function prediction only].
cd12215	ChiC_BD	1.86e-08	41	74	8	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
cd00036	ChtBD3	5.37e-08	41	74	7	40	Chitin/cellulose binding domains of chitinase and related enzymes. This group contains proteins related to the cellulose-binding domain of Erwinia chrysanthemi endoglucanase Z (EGZ) and Serratia marcescens chitinase B (ChiB). Gram negative plant parasite Erwinia chrysanthemi produces a variety of depolymerizing enzymes to metabolize pectin and cellulose on the host plant. Cellulase EGZ has a modular structure, with an N-terminal catalytic domain linked to a C-terminal cellulose-binding domain (CBD). CBD mediates the secretion activity of EGZ. Chitinases allow certain bacteria to utilize chitin as a energy source. Typically, non-plant chitinases are of the glycosidase family 18. Bacillus circulans Glycosidase ChiA1 hydrolyzes chitin and is comprised of several domains: the C-terminal chitin binding domain, an N-terminal catalytic domain, and 2 fibronectin type III-like domains. Bacillus circulans WL-12 ChiA1 facilitates invasion of fungal cell walls. The ChiA1 chitin binding domain is required for the specific recognition of insoluble chitin. although topologically and structurally related, ChiA1 lacks the characteristic aromatic residues of Erwinia chrysanthemi endoglucanase Z (CBD(EGZ)). Streptomyces griseus Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. ChiC contains the characteristic chitin-binding aromatic residues. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ22218.1	1.17e-177	1	369	1	356
BBB00311.1	2.93e-177	1	369	1	362
AWS46507.1	5.30e-177	1	369	1	359
BCB84721.1	1.07e-176	1	369	1	359
BCB79550.1	4.49e-176	1	369	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1WVU_A	2.48e-137	31	369	2	265	Crystalstructure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
1WVV_A	7.09e-137	31	369	2	265	ChainA, chitinase C [Streptomyces griseus],1WVV_B Chain B, chitinase C [Streptomyces griseus]
2CJL_A	1.20e-120	166	369	1	204	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
3WH1_A	5.48e-56	168	369	8	206	CrystalStructure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	7.49e-56	168	369	7	205	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5NTA4	6.14e-49	165	369	79	281	Endochitinase 4 OS=Cryptomeria japonica OX=3369 PE=1 SV=1
Q6K8R2	1.82e-48	182	369	92	271	Chitinase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht6 PE=2 SV=1
P29022	2.33e-48	183	369	105	280	Endochitinase A OS=Zea mays OX=4577 GN=CHIA PE=1 SV=1
O04138	2.22e-46	167	369	87	285	Chitinase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht4 PE=2 SV=2
P24626	2.80e-46	167	369	79	311	Chitinase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht3 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000387	0.998750	0.000228	0.000266	0.000185	0.000156

TMHMM  Annotations     

start	end
5	27