CAZyme Information: MGYG000001416_00307

Basic Information

• Species: Cellulomonas massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas massiliensis
• CAZyme ID: MGYG000001416_00307
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645		71118.89	6.4111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001416	3245988	Isolate	not provided	not provided

• Gene Location: Start: 345116; End: 347053 Strand: +

Full Sequence      

MSRLLLLRVVATLTIVLGVNYVVWRWLESVNWSAWWIAVPLVLAETYSVVDVTLFGLTMW
RARTRPAPPAPGPGLTVDVFVTTYDEPVDLVLRTAEAARDLRYPHRTWVLDDGARPELAA
AAADAGVGYLVRTADWEGRNRHAKAGNLNNALFQTDGEFLVVLDADQIPDPELLHRTLGY
FSDPQVALVQTPQYFTNVPEADPLGSQAPLFYGPIQQGKDGWNAAFFCGSNAVLRREALM
QLGLVGYVRATDQAVREALRASRTVLARARRRADDPRVAAAVDEVSSAARSSLALLDAGE
PLADVTYAFQRRVDEVSAAVVGTDVAAMRADLEAIGAWPVETDSELGAPVVDEEALARLT
DREWSPLGALASVQALVRAVDVDRADEAQPVMPVATLSVTEDMATAMRLHALGWRTVYHH
ERLAHGLAPEDLGTMITQRLRWAQGTMQVFLQENPLRVPGLRFGQRLMYLATMWSYLSGF
AAVVYLAAPIIFLCFGVLPVTAWTWDFFARFLPFQLASQVLFLVAARGIRTWRGQQYSLA
LFPVWIRATWTAAANVWFGRPLGFAVTPKVRQDGRGSWRLVLPQLVAMGALVVAAVVGIA
RWGLGYAPWVGTWVNLLWVAYDLVVLSVIVQALRYRGYTGAERMG

Enzyme Prediction     

No EC number prediction in MGYG000001416_00307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	78	242	9.4e-27	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	1.02e-85	76	450	2	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	1.90e-62	8	626	183	669	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	2.13e-32	22	570	1	412	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.87e-16	79	243	1	170	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	1.74e-15	78	239	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHT55281.1	0.0	1	644	1	644
VEH36812.1	0.0	1	644	1	644
AEE47694.1	0.0	1	644	1	644
AEI11458.1	0.0	1	638	1	638
ADG75503.1	5.62e-315	1	638	1	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.44e-45	6	627	200	683	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	6.03e-40	17	569	64	496	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	8.68e-40	17	569	76	508	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	8.71e-40	17	569	77	509	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7D5K_A	3.74e-08	142	609	514	970	ChainA, Cellulose synthase [Gossypium hirsutum],7D5K_B Chain B, Cellulose synthase [Gossypium hirsutum],7D5K_C Chain C, Cellulose synthase [Gossypium hirsutum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	1.15e-48	2	630	81	572	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q9WX75	9.97e-48	13	599	78	527	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
Q9RBJ2	9.97e-48	13	599	78	527	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
Q76KJ8	4.38e-47	18	496	86	427	Cellulose synthase 1 OS=Komagataeibacter hansenii OX=436 GN=acsAB PE=1 SV=1
P0CW87	4.38e-47	18	496	86	427	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	24
34	56
475	497
507	529
580	602
607	629