CAZyme Information: MGYG000001416_00342

Basic Information

• Species: Cellulomonas massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas massiliensis
• CAZyme ID: MGYG000001416_00342
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490		51895.73	7.8863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001416	3245988	Isolate	not provided	not provided

• Gene Location: Start: 376026; End: 377498 Strand: +

Full Sequence      

MTLLPSTARRGPARTRRRTARTRLVTALLGALVLVGGAALVVVTAPAGTAAPTCGTLFDD
FSYTSRTDPALASHGWRVRTSAGGPGVGGAAWSADNVTFDSVDGQRSLRLRAATNGTAAG
TSHAEVSQQARRFREGTYLARIKFADVPESGPDGDHVNQTFYSISPLAYAFDPTYSELDF
AEYLPNGGWGTSTPTDYVTSWYTYQADPWVADNQSTTLAGSLAGWHDVMATVGGGTIRYY
VDGRLVGTHSGKVYPRQDMSIDFNQWFIDLAGHGSGTSVWRQSVDYVLHAEDQVLTPAQA
GAAVASLRQQGLAHVDTIGRQSGCSATPPAPTPSATATRTPTASPTPTASPTPTASPTPT
LPAGTRTVVSDLNGKCLDVPAWSFSPGVRVVMWACDGETKQRWQAVGRTLRTQNDLCLDV
AGAGTANGTPVQIARCNGNAAQDWVLGADRTLRNPASGRCLDIDGWRATDGARLIVWDCH
GGANQRWRLV

Enzyme Prediction     

No EC number prediction in MGYG000001416_00342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	365	488	9.6e-31	0.6702127659574468
GH16	58	287	7.4e-18	0.9682539682539683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00652	Ricin_B_lectin	6.75e-26	367	487	4	126	Ricin-type beta-trefoil lectin domain.
NF035929	lectin_1	1.20e-24	374	489	721	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
cd00161	RICIN	1.27e-23	370	489	6	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
smart00458	RICIN	1.92e-23	369	490	2	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
cd00413	Glyco_hydrolase_16	1.23e-22	59	287	1	207	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGZ39149.1	3.70e-138	42	459	25	424
ADB29204.1	3.68e-113	51	318	42	314
AGL20089.1	1.41e-108	28	328	7	306
QZD57928.1	1.43e-108	47	341	3	296
UAC01072.1	4.69e-108	44	403	33	357

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.947799	0.051038	0.000294	0.000172	0.000119	0.000608

TMHMM  Annotations     

start	end
24	46