CAZyme Information: MGYG000001416_00664

Basic Information

• Species: Cellulomonas massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas massiliensis
• CAZyme ID: MGYG000001416_00664
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		62852.1	9.0405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001416	3245988	Isolate	not provided	not provided

• Gene Location: Start: 715433; End: 717172 Strand: +

Full Sequence      

MSPRSDEQHGEPLRRRAAELGRATAMLVGGALALLAVEVWLLVNGPATSEREASRPGVLP
FHGVGVAAFLAAGALTAATFVALAALQTAAAMRVLSPHRQLPPPLPAPAQRLRRIALAPA
ALRRLEVEEPPAWPPSAVPSEQERPPAGARLRCHVLIPAHDEEAVIDGTLASLRAQTRPP
DDVLVIADNCADHTVEAALAAGVRVVETVGNTEKKAGALNQELARLLPTATPGDVVLVMD
ADSTIDPEFLEVAMGLLEEDPDLMAVGGLFYGEPGGRLVGQCQRNEYSRYQRLVARRLNR
VFVLTGTASVIRTYALDAVARARGPLIPGPPGQVYDTVALTEDNELTLALRSLGARMTSP
PQCIVTTEIMPTWRDLWRQRQRWYRGALENIGAYGLTRATLRYWLQQLGLSYGVVALYSF
LALFAITMLAADQLMWSPFWVTVGLIFFVERLATVWAAGRRARLLALPVVPELLYSAVLQ
ACYVASLWRILVHARADWNYVPRAAVHAVVPLAVVVPVLLSQGVLLPASILHTTWYHTLS
LWVGFNTLVFAALSLVQLLPPLSPAARRSAREARLAARR

Enzyme Prediction     

No EC number prediction in MGYG000001416_00664.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	152	386	3.4e-28	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.93e-39	155	343	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.71e-37	155	491	58	379	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06438	EpsO_like	6.58e-25	155	252	1	101	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
pfam00535	Glycos_transf_2	5.88e-22	155	316	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13641	Glyco_tranf_2_3	2.33e-19	152	386	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADG73294.1	1.67e-133	155	501	162	508
QSF57883.1	1.14e-131	155	488	118	451
SDT42057.1	2.19e-130	155	505	118	468
QBX55206.1	5.80e-130	155	501	118	464
QDY89275.1	9.64e-130	151	508	116	477

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	2.20e-12	155	386	53	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
62	84
408	430
473	492
504	526
541	563