CAZyme Information: MGYG000001416_01418

Basic Information

• Species: Cellulomonas massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas massiliensis
• CAZyme ID: MGYG000001416_01418
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		77363.34	6.4098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001416	3245988	Isolate	not provided	not provided

• Gene Location: Start: 1505725; End: 1507902 Strand: +

Full Sequence      

MRRGALARRPGVARRRPRDEHPRPHHPGRATRPRPPRGAAAATRRVSTITALAVLVTAVA
APAVASSPARGRGDAPRPGVETVAGIDPSLLLGRGADVAYVEQEAENAAYTGALVGPDRD
AFTFASEASGRTAVELEPGEHVRFTLTRDANALTVRYALPDAPRGGGLSGTLDLTAAGVS
RSVPVTSRYSWLYNQYPFTNDPTAGLLHPDWWVAECGCVPAQTTPAPVFDTPFRPSHAYA
EQRVLLGRTVRAGGTVTLTLPRRSALPWAVIDLVDLEKVGPPQAAPRGAVNAWLLGADPT
GRRDAARPLRQAVALAKKLDRPVYVPPGTYRLSEHLVVDDVTIAGAGSWYTVFRGREVAL
SEPAPDGSTHTGVGFYGRPAAQGGSHDVHLRDFAIVGDVAERIDDDQVNGIGGAMSDSSI
SGLYIKNTKVGLWFDGPMSNLRVERNVVVDQIADGLNFHRGVTDSVVRDNVFRNTGDDAL
ASWSQDVPNARNVFDSNTIQVPTLANGIALYGGTDLTVSNNVVADPVREGSALHLGSRFG
ATPFVGTISVRDNTTVRGGPLEPNWKIGTGALWVYALERSIDADVQVVGDHFLDSTYNAV
MLVAEWGVKDQYSIENVHLRDVRIDGTGTNAISARAMGSATFENVDARNLGSYGVNNCGA
FHWDWEHGSEFTLVDLGGNDGTSGNPWDASTNNWLTRFTPNTITCNDTPPVVAPPAPSPW
QQPVG

Enzyme Prediction     

No EC number prediction in MGYG000001416_01418.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	92	657	5e-157	0.8458961474036851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	6.04e-49	95	276	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
pfam13229	Beta_helix	4.25e-05	416	554	9	133	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	1.47e-04	394	599	4	179	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam12708	Pectate_lyase_3	0.001	296	525	8	207	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARU51449.1	1.96e-316	69	725	36	696
QJW35113.1	4.07e-316	78	725	46	697
QHT56718.1	6.07e-304	43	720	16	689
QQQ76625.1	1.66e-303	45	720	3	659
QXE33028.1	1.05e-302	34	720	36	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7C7D_A	6.50e-115	95	690	54	581	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
5ZRU_A	9.05e-35	94	650	12	561	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
6K0M_A	1.78e-31	89	581	8	474	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	1.82e-30	89	581	8	474	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	1.82e-30	89	581	8	474	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.802950	0.178857	0.010549	0.005747	0.001134	0.000751

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001416_01418.