CAZyme Information: MGYG000001416_01423

Basic Information

• Species: Cellulomonas massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas massiliensis
• CAZyme ID: MGYG000001416_01423
• CAZy Family: CE14
• CAZyme Description: Regulator of RpoS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		38618.59	5.0218

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001416	3245988	Isolate	not provided	not provided

• Gene Location: Start: 1511311; End: 1512411 Strand: +

Full Sequence      

MGDEQLTVLVVEDDPDTAQFVRTVLERRAGMAVTVVHEPMSALAEVARQTFDAVLTDIQM
PGMSGLELLGELRAHAAGVPVAVMTAFASVDYAVEALRRDADDFLVKPVSAAALVEKVTA
LARLGRTRREQAAPAQTVLAIGAHPDDVEIGVGATLAAHAAAGDAIVILTLSSGAVGGDV
QQRRHEALAAAAHVGARLFLHDFADTRLDPADGLITTIEQTIREVEPAVVYTHSAADRHQ
DHRAVREATEVAARRVPTLACYQSPSSTIAFAPSRFVPVDAYLDTKLEMLAAFSSQAHRD
YLDPELVRATARYWSRFGAGARYAEPLEVLREGAVVRGAAGPGARAAGVPRPATGATTGP
TGEDEG

Enzyme Prediction     

No EC number prediction in MGYG000001416_01423.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	139	241	3.4e-19	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00072	Response_reg	3.83e-31	8	118	1	110	Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.
cd00156	REC	1.01e-29	9	108	1	99	phosphoacceptor receiver (REC) domain of response regulators (RRs) and pseudo response regulators (PRRs). Two-component systems (TCSs) involving a sensor and a response regulator are used by bacteria to adapt to changing environments. Processes regulated by two-component systems in bacteria include sporulation, pathogenicity, virulence, chemotaxis, and membrane transport. Response regulators (RRs) share the common phosphoacceptor REC domain and different effector/output domains such as DNA, RNA, ligand-binding, protein-binding, or enzymatic domains. Response regulators regulate transcription, post-transcription or post-translation, or have functions such as methylesterases, adenylate or diguanylate cyclase, c-di-GMP-specific phosphodiesterases, histidine kinases, serine/threonine protein kinases, and protein phosphatases, depending on their output domains. The function of some output domains are still unknown. TCSs are found in all three domains of life - bacteria, archaea, and eukaryotes, however, the presence and abundance of particular RRs vary between the lineages. Archaea encode very few RRs with DNA-binding output domains; most are stand-alone REC domains. Among eukaryotes, TCSs are found primarily in protozoa, fungi, algae, and green plants. REC domains function as phosphorylation-mediated switches within RRs, but some also transfer phosphoryl groups in multistep phosphorelays.
COG2204	AtoC	7.53e-28	7	136	6	134	DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains [Signal transduction mechanisms].
cd17574	REC_OmpR	1.73e-27	9	108	1	99	phosphoacceptor receiver (REC) domain of OmpR family response regulators. OmpR-like proteins are one of the most widespread transcriptional regulators. OmpR family members contain REC and winged helix-turn-helix (wHTH) DNA-binding output effector domain. They are involved in the control of environmental stress tolerance (such as the oxidative, osmotic and acid stress response), motility, virulence, outer membrane biogenesis and other processes. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.
COG0745	OmpR	1.02e-26	8	142	3	134	DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain [Signal transduction mechanisms, Transcription].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG69054.1	1.24e-23	138	326	3	190
BCG98255.1	3.30e-23	138	326	3	190
BCH05956.1	2.25e-21	138	326	3	190
AGZ44631.1	3.69e-18	136	331	3	218
AGL19726.1	3.71e-16	136	325	4	195

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DC7_A	9.61e-14	8	117	6	117	ChainA, NITROGEN REGULATION PROTEIN [Salmonella enterica subsp. enterica serovar Typhimurium],1J56_A Chain A, NITROGEN REGULATION PROTEIN NR(I) [Salmonella enterica subsp. enterica serovar Typhimurium],1KRW_A Chain A, NITROGEN REGULATION PROTEIN NR(I) [Salmonella enterica subsp. enterica serovar Typhimurium],1KRX_A Chain A, NITROGEN REGULATION PROTEIN NR(I) [Salmonella enterica subsp. enterica serovar Typhimurium],1NTR_A Chain A, NTRC RECEIVER DOMAIN [Salmonella enterica subsp. enterica serovar Typhimurium],2MSK_A Solution Structure and Chemical Shift Assignments for BeF3 activated Receiver Domain of Nitrogen Regulatory Protein C (NtrC) at 35C [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1],2MSL_A Solution Structure and Chemical Shift Assignments for the Apo form of the Receiver Domain of Nitrogen Regulatory Protein C (NTRC) at 35C [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1]
2OQR_A	1.68e-13	7	125	6	122	Thestructure of the response regulator RegX3 from Mycobacterium tuberculosis [Mycobacterium tuberculosis H37Rv]
3NNN_A	1.72e-13	8	123	5	119	BeF3Activated DrrD Receiver Domain [Thermotoga maritima],3NNN_B BeF3 Activated DrrD Receiver Domain [Thermotoga maritima]
5EP0_A	2.98e-13	4	111	3	109	Quorum-SensingSignal Integrator LuxO - Receiver+Catalytic Domains [Photobacterium angustum]
6ONT_A	7.70e-13	8	121	10	122	Structureof the Francisella response regulator 1452 receiver domain [Francisella tularensis subsp. novicida U112]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71311	3.98e-21	138	295	19	185	Uncharacterized deacetylase YaiS OS=Escherichia coli (strain K12) OX=83333 GN=yaiS PE=3 SV=1
Q9APD9	4.10e-15	1	109	1	108	Transcriptional regulatory protein ZraR OS=Klebsiella oxytoca OX=571 GN=zraR PE=3 SV=1
Q9I4N3	2.61e-14	8	118	5	114	Response regulator protein FleR OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=fleR PE=3 SV=1
O69730	3.28e-14	4	123	7	125	Probable transcriptional regulatory protein TcrX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tcrX PE=1 SV=3
Q9F868	1.91e-13	7	125	3	119	Sensory transduction protein RegX3 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=regX3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001416_01423.