CAZyme Information: MGYG000001416_02009

Basic Information

• Species: Cellulomonas massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas massiliensis
• CAZyme ID: MGYG000001416_02009
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
122		11776.76	8.3112

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001416	3245988	Isolate	not provided	not provided

• Gene Location: Start: 2164080; End: 2164448 Strand: -

Full Sequence      

MRALTAAVAGGLALDLGGRTDLAGLAAVLAGAQVVVVGNTGPAHLAAAVGTPVVSLFSPV
VPAARWRPWRVPHVVLGDQGAPCAGTGARACPVPGHPCLASVPAEAVVAAVDALRAAQAV
VA

Enzyme Prediction     

No EC number prediction in MGYG000001416_02009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	3	93	8.1e-24	0.37777777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.50e-14	6	99	171	263	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	3.05e-07	15	83	167	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	3.50e-07	36	84	255	305	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK10422	PRK10422	5.93e-06	39	69	270	299	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ19459.1	2.83e-48	2	119	227	346
QWC17619.1	4.37e-48	4	114	237	345
ALV52930.1	6.28e-48	2	114	213	325
AEE46718.1	2.35e-46	15	114	243	342
VEH33976.1	2.35e-46	15	114	243	342

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.946074	0.050100	0.003034	0.000349	0.000164	0.000284

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001416_02009.