CAZyme Information: MGYG000001417_02301

Basic Information

• Species: Noviherbaspirillum massiliense
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Noviherbaspirillum; Noviherbaspirillum massiliense
• CAZyme ID: MGYG000001417_02301
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		36646.53	9.1248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001417	4171493	Isolate	not provided	not provided

• Gene Location: Start: 2421990; End: 2423009 Strand: -

Full Sequence      

MVASGILIVALKMRGEAVLAKRHVVIISPAMAKANNGNWQTARRWARFLGERYRVTLLER
WNGIACDAVIALHARRSASSIASFAAAFPERPCILVLTGTDLYRDIHADAEAQRSLQFAT
RLVVLQEAGLQELPEEGRAKARVIYQSAPALAPVVCHEPGDAEVVMIGHLRDEKDPLVFM
HAAAMVKAPGLRMTHIGGALDPALGEQAMATQQAVPHYRWLGSLPHDATRERLRRSRLMV
IASKIEGGANVIIEAVTSVVPVLASDIPGNRGMLGADYAGYFPVGDSKALAALIDKALAD
SAFHALLQDQCKARAALFAPEREQAAVLQLLDNLAPKTR

Enzyme Prediction     

No EC number prediction in MGYG000001417_02301.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04348	TIGR04348	4.01e-143	24	333	1	310	putative glycosyltransferase, TIGR04348 family. This putative glycosyltransferase is found in marine bacteria such as Marinobacter and soil bacteria such as Anaeromyxobacter, but does not seem to occur in known pathogenic bacteria.
cd03801	GT4_PimA-like	1.13e-18	19	331	27	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.04e-17	27	334	60	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	2.08e-15	160	305	1	149	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03798	GT4_WlbH-like	2.44e-12	113	334	145	376	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDZ30516.1	2.09e-136	19	336	1	319
QBQ39103.1	7.96e-135	24	334	7	319
AXA91499.1	1.27e-130	23	334	8	322
ALK96654.1	2.40e-130	19	334	1	317
AVR96311.1	2.25e-129	26	334	3	314

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6DIQ1	1.27e-06	157	280	159	285	Glycosyltransferase 1 domain-containing protein 1 OS=Xenopus tropicalis OX=8364 GN=glt1d1 PE=2 SV=1
Q5RAF1	2.26e-06	165	280	169	286	Glycosyltransferase 1 domain-containing protein 1 OS=Pongo abelii OX=9601 GN=GLT1D1 PE=2 SV=1
Q96MS3	2.26e-06	165	280	169	286	Glycosyltransferase 1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GLT1D1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999824	0.000213	0.000008	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001417_02301.