CAZyme Information: MGYG000001417_02414

Basic Information

• Species: Noviherbaspirillum massiliense
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Noviherbaspirillum; Noviherbaspirillum massiliense
• CAZyme ID: MGYG000001417_02414
• CAZy Family: GT41
• CAZyme Description: Photosystem I assembly protein Ycf3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769	MGYG000001417_1|CGC20	84795.74	7.2433

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001417	4171493	Isolate	not provided	not provided

• Gene Location: Start: 2532102; End: 2534411 Strand: +

Full Sequence      

MPLTKLLSAFAKRKSPHPITSSALSAHSAQKTAFMPAKASDIGSKLLDAVALHKQGQLAR
AEAAYQEILQAQPRHFDALHYLGLMALQRGKTEEGIALIGQALEIDAKHPAALGNLAMAL
RQLGRHEEALAHYRRALDIKPDSADIGYNFVNTLLNLQRHEEALDICSRTLRLIPNAAPL
LQQRGTALLLLRRYEESIADFDRALALQPDYPEALANRGVALTAINRNADAVASYTRVLQ
LNANDVEARYNRGISLAKLGRLAEALIDYEQVLQGKPDHLGALNNLGTALSALGRFEAAI
PVYKKLLALAPDYDYAPGNLFACQLYCCDWSDYEKSRQAVVEMNRQGRKAAVPFPFLNAS
ESPADQLACARAFVAHTFPASSHPLWTGRRYQHEKIRVAYLSADFQEHATAHLMAGLFEA
HDRQRFETIAISYGPDARGGMRERLQSAFDRFIDVREKSDLEAARIMQALEVDIAVDLKG
FTENSRLGILAHRPSPVQVSYLGYPGTTGADYVDYAICDKHLVSEGELGSFSEQLVFLPD
SYQVNDSKRPISAQVPTRAEAGLPEKTFVFCSFNNNYKITPAVFDIWMRLLHQIAGSVLW
LYEGNAAAAANLRREAQARGIAPEQLVFAPRLPQAEHLARQQLADLFLDTLPVNAHTTAS
DALWAGLPVLTCTGQAFAGRVATSLLHAVGLPELVTQSLDEYEALALRLASMPAELARIK
AKLAHNRSTYPLFNTVRFCRHLEAAYVEMWERSQRGEAPAGFSVPAMLH

Enzyme Prediction     

No EC number prediction in MGYG000001417_02414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	242	755	6.9e-135	0.5645390070921986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3914	Spy	1.25e-133	205	755	58	620	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
pfam13844	Glyco_transf_41	2.13e-76	328	742	2	543	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
TIGR02917	PEP_TPR_lipo	1.25e-22	22	312	543	835	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
TIGR02917	PEP_TPR_lipo	6.02e-20	41	320	226	505	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
TIGR02917	PEP_TPR_lipo	6.45e-20	40	312	327	633	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDZ26943.1	5.38e-191	341	765	376	800
AHN97621.1	4.49e-169	315	754	309	748
AXK80282.1	2.84e-168	314	765	231	682
SHI02176.1	1.01e-167	316	759	182	625
SHK35404.1	2.49e-167	316	759	173	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JLB_A	2.08e-74	328	723	139	533	Xanthomonascampestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
2VSN_A	5.58e-74	328	723	139	533	Structureand topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
6Q4M_A	2.55e-61	323	759	154	715	Crystalstructure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
6IBO_A	3.50e-61	323	759	154	715	Catalyticdeficiency of O-GlcNAc transferase leads to X-linked intellectual disability [Homo sapiens]
5NPR_A	4.38e-61	323	759	148	709	Thehuman O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9M8Y0	2.31e-78	320	764	502	966	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
Q8CGY8	9.49e-60	323	759	472	1033	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
P81436	4.28e-59	323	759	472	1033	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
O15294	5.78e-59	323	759	472	1033	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
Q27HV0	1.42e-58	323	759	472	1033	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001417_02414.