CAZyme Information: MGYG000001418_00687

Basic Information

• Species: Aeromicrobium massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Nocardioidaceae; Aeromicrobium; Aeromicrobium massiliense
• CAZyme ID: MGYG000001418_00687
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656	MGYG000001418_1|CGC2	73556.61	5.6956

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001418	3314835	Isolate	not provided	not provided

• Gene Location: Start: 673731; End: 675701 Strand: -

Full Sequence      

MSPRLLLIRVIVVLTAILGVNYVLWRWLESVHWSAWWIAVPLVVAETYSLVDSLLFGLTM
WRLKERGEPPAPPEDATVDVFITTYNEPIDLVMRTARAAQAITYPHTTWILDDGNRDELR
AVAEAEGIGVINRSGDWTPDRPRHAKAGNLNNALLATEGEYLLILDADQVPRPEILDRTL
GWFRDDQMALVQTPQWFENVPDDDPLGSQAPLFYGPIQQGKDGWNAAFFCGSNAVIRREA
LMMLGVTRYAGEVEIGVHRALRTARRVLARARKELGPDDETARRALDLVGYEIGRARREI
ARGIALADVTYRFQRRMDDVRRILVDADLQALQADLAEIAAMERQADAQPGTGLATIDET
TLEHMASRDWSPLGAVETVSALVSAVDVDRGEEAQPVMPLATISVTEDMATCMRLHGLGW
RTAYHDEVLAHGLAPEDLPTMLTQRLRWAQGTMQVLFRENPLAQRRLRWSQRLMYFATMW
SYLSGFAALVYLAAPILYLAVGVLPVQAYGPDFFIRLVPFLVVNQLLFLVVAAGRPTWRG
QQYSLALFPTWIKAFTSAFGNVFLRRDLDFAVTPKTRPASTGPAWHLVRPQLWAMAALAA
AAVIGAVRYAVGQATLVGWSLNTLWVIFDLAIFSIIIRAARYRGFEPDHEEDHDRL

Enzyme Prediction     

No EC number prediction in MGYG000001418_00687.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	79	241	4.1e-25	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	2.24e-85	77	456	2	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	1.04e-64	3	499	185	535	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	2.87e-33	23	576	1	412	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	7.52e-18	80	245	1	170	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	2.28e-16	79	241	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANH39919.1	0.0	1	647	1	645
ABL82334.1	0.0	4	650	12	656
QIG46220.1	0.0	2	647	6	651
QOD43199.1	7.63e-318	1	651	14	662
QIS39713.1	4.67e-317	1	651	1	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.71e-42	11	499	202	548	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	6.07e-37	1	593	51	514	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	8.13e-37	1	593	63	526	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	8.16e-37	1	593	64	527	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7D5K_A	3.42e-07	404	576	738	923	ChainA, Cellulose synthase [Gossypium hirsutum],7D5K_B Chain B, Cellulose synthase [Gossypium hirsutum],7D5K_C Chain C, Cellulose synthase [Gossypium hirsutum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	2.50e-48	3	502	80	437	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q9WX75	5.96e-43	11	641	75	565	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
Q9RBJ2	5.96e-43	11	641	75	565	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
P37653	1.42e-41	11	499	202	548	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q8X5L7	1.91e-41	11	499	202	548	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	25
35	57
481	503
513	532
545	564
592	611
618	640